University of California Press Berkeley and Los Angeles, California University of California Press, Ltd. London, England Copyright © 1974 by The Regents of the University of California ISBN: 0-520-01476-6 Library of Congress Catalog Card Number: 73-92376 Printed in the United States of America CONTENTS PREFACE xiii 1 INTRODUCTION 3 1.1 PURPOSE OF T H E STUDY 3 1.2 USES FOR TEXTS AND TABLES 4 2 PROCEDURES 11 2.1 SOURCES OF MATERIAL 11 2.1.1 Spoken Language 2.1.2 Written Language 2.2 TRANSCRIPTION PROCEDURES 16 2.2.1 Spoken Language 2.2.2 Written Language 2.3 STATISTICAL METHODS 18 v vi CONTENTS 3 DISCUSSION OF THE STATISTICAL TABLES 23 3.1 DISCUSSION OF FIRST-ORDER TABLES 23 3.2 DISCUSSION OF HIGHER-ORDER TABLES 40 3.3 FIGURES Figure 3.3.1 Relative Sequential Constraint in Letter and Phonemic Transcriptions of the Speech of First Graders and Adults and in a First Reader Figure 3.3.2 Relative Sequential Constraint for Several Written Texts Figure 3.3.3 Frequency Distribution of Letters from Adult Speech and Adult Text Figure 3.3.4 Relative Sequential Constraint in Three Levels of Children's Freereading Choices 30 35 36 38 4 APPENDIX 48 4.1 TRANSCRIPTION RULES 48 4.2 RULES USED FOR PREPARING LETTER TRANSCRIPTIONS OF SPEECH 49 4.3 PHONEMIC ALPHABET 50 5 REFERENCES 53 6 THE RUNNING TEXTS 57 6.1.1 LETTER TRANSCRIPTION-FIRST GRADE 58 6.1.2 PHONEMIC TRANSCRIPTION-FIRST GRADE 59 6.2.1 LETTER TRANSCRIPTION-THIRD GRADE 148 6.2.2 PHONEMIC TRANSCRIPTION-THIRD GRADE 149 6.3.1 LETTER TRANSCRIPTION-FIFTH GRADE 244 CONTENTS vii 6.3.2 PHONEMIC TRANSCRIPTION-FIFTH GRADE 245 6.4.1 LETTER TRANSCRIPTION-ADULT 366 6.4.2 PHONEMIC TRANSCRIPTION-ADULT 367 7 FIRST-ORDER STATISTICAL TABLES 441 Table 7.1 Frequency and Proportion of Letters in Natural Speech Table 7.2 Frequency and Proportion of Phonemes in Natural Speech Table 7.3 Rank Order of Vowel and Consonant Phonemes by Frequency of Occurrence in First, Third, and Fifth Grade and Adult Speech Table 7.4 Frequency and Proportion of Phonemes in Natural Speech Classified according to Articulatory Categories in First, Third, and Fifth Grade and Adult Speech Table 7.5 Product-moment Correlation Matrix for 22 Consonant Phonemes from 16 Sets of Data Table 7.6 Relative Sequential Constraint in Letter and Phonemic Transcriptions of First, Third, and Fifth Grade and Adult Speech Table 7.7 Comparison of Adult and Child Reading Material in Terms of Information, Constraint, and Mean Word and Sentence Length Table 7.8 Proportions of Each Letter in Adult and Child Reading Material and Adult and Child Speech Table 7.9 Product-moment Correlation Matrix for Relative Frequencies of 26 Letters from Ginn Readers, Adult Printed Language, and First, Third, and Fifth Grade and Adult Speech Table 7.10 Relative Sequential Constraint in Children's Free-reading Choices Table 7.11 Relative Sequential Constraint as Affected by Sample Size 8 HIGHER-ORDER STATISTICAL TABLES 457 8.1 TABLES OF DIAGRAMS 458 8.1.1 8.1.2 8.1.3 8.1.4 First Grade Third Grade Fifth Grade Adult CONTENTS vili 8.2 TABLES OF DIPHONES 8.2.1 8.2.2 8.2.3 8.2.4 466 First Grade Third Grade Fifth Grade Adult 8.3 TABLES OF RANK ORDER 474 8.3.1 Rank-order and Frequency of Word-initial Letters for First, Third, and Fifth Grade and Adult Speech 8.3.2 Rank-order and Frequency of Word-final Letters for First, Third, and Fifth Grade and Adult Speech 8.4.1 Rank-order and Frequency of Phrase-initial Phonemes for First, Third, and Fifth Grade and Adult Speech 8.4.2 Rank-order and Frequency of Phrase-final Phonemes for First, Third, and Fifth Grade and Adult Speech 8.5 PROPORTIONS OF VOWELS AND CONSONANTS IN WORDFINAL, AND OVERALL POSITION FOR LETTERS AND PHONEMES, FOR FIRST, THIRD, AND FIFTH GRADE, AND ADULT SPEECH 478 8.6 TABLES OF TRIGRAMS 8.6.1 8.6.2 8.6.3 8.6.4 First Grade Third Grade Fifth Grade Adult 8.7 TABLES OF WORD-INITIAL TRIGRAMS 8.7.1 8.7.2 8.7.3 8.7.4 479 505 First Grade Third Grade Fifth Grade Adult 8.8 TABLES OF WORD-FINAL TRIGRAMS 8.8.1 First Grade 8.8.2 Third Grade 8.8.3 Fifth Grade 8.8.4 Adult 521 CONTENTS 8.9 TABLES OF TRIPHONES 8.9.1 8.9.2 8.9.3 8.9.4 ix 537 First Grade Third Grade Fifth Grade Adult 8.10 TABLES OF WORD-INITIAL TETRAGRAMS 8.10.1 8.10.2 8.10.3 8.10.4 First Grade Third Grade Fifth Grade Adult 8.11 TABLES OF WORD-FINAL TETRAGRAMS 8.11.1 8.11.2 8.11.3 8.11.4 615 First Grade Third Grade Fifth Grade Adult 631 PREFACE PREFACE ACKNOWLEDGMENTS 1. The U.S. Office of Education, through Project OE-1877, supported the initial phase of the study, including collection of data, key-punching of texts, and the statistical analysis of first-order tables and sequential constraints. Support for higher-order analyses and preparation of the manuscript came from the U.S. Public Health Service, National Institute of Mental Health (Grant MH-07809). The Hope for Hearing Foundation, Los Angeles, California, provided funds to defray the cost of typing the phonemic texts and tables as well as their proofreading. The University of California Press, through its Scientific Fund, graciously bore the original pulication cost. We are particularly grateful for the encouragement of Mr. Robert Zachary, Los Angeles Editor of the Press, and Mr. James Kubeck, Managing Editor of the Press in Los Angeles. There is no brief way of saying how much we are in the debt of Mrs. Claudia Seapy (the former Miss Croteau), Professor David W. Packard, and Mr. Howard Golden. The help they gave in editing, in the design of type and format, and in expert consulting on the arts of computer typesetting and programming is incalculable. Mere money could never pay our debt to them. 2. Computing assistance was obtained from the Health Sciences Computing Facility, UCLA, sponsored by National Institutes of Health Grant FR-3, and from the UCLA Campus Computing Network. 3. We owe thanks to many people for their assistance in arranging for subjects and space, and especially to Mr. Kyle Esgate, Mr. William Haley, Mrs. Esther S. McGinnis, Dr. John D. McNeil, Mrs. Marjorie M. Rohrbough, and Mrs. Genie Swinney. 4. Thanks are due also to our Psychology research assistants over the course xiii xiv PREFACE of the project: Janis Stone, Dolores D. Kluppel, and S. Joyce Brotsky, and to our phoneticians: Elite Ohlstain, Robert Chamberlain, Jane Chamberlain, and Herman Pevner. In addition a number of people have spent many tedious hours transcribing tapes, punching IBM cards, typing tables, coding phonetic texts into Fortran symbols and proofing. To them all we owe thanks for a job well done, but especially to Lori Bohlmann, Judith Hayward, Mary Ann Nakagawa, Gudrun Ulman, and Cheryl Grossman. 5. We thank Dr. Peter Neely and Mssrs. Charles Goldberg, John Dewey Lovell, and Robert Madigan for having written some useful and complex computer programs. 1 INTRODUCTION 1.1 PURPOSE OF THE STUDY 1.2 USES FOR TEXTS AND TABLES INTRODUCTION 1.1 P U R P O S E O F T H E S T U D Y In spite of a vast amount of interest in language, there is very little information available about the informal spoken language. Yet psychologists, linguists, psycholinguists, and educators need such information for both research and curricular purposes. Among other things, the native language, the spoken dialect learned mainly at the mother's knee, is the most overlearned behavior in an individual's entire repertoire. It is important for many purposes to know how different it is from the formal written language, when can learning of the native language be considered virtually complete, what are the natural units, what is usual and what unusual in speech. Some description of "standard" spoken language by means of which to measure dialectical variations is doubtless important too. This monograph will not answer all these questions but we hope that it will throw some light on them. All previous statistical studies of language known to us have derived their material from written language, whatever the claims.1 It is part of our purpose to show that genuine spoken language is actually quite different from written language; even on such a gross level as proportional frequencies of letters and phonemes. To this end many sorts of comparisons of spoken and written language will be presented. A second purpose is the comparison of informal spoken language across the age range from 6 years to adulthood, in terms which permit of some quantitative evaluation, with an eye to estimating the rate of maturation of native 1 A possible exception is the groundwork for the St. Cloud method of teaching French as a second language (Gougenheim et al., 1956), but the language sample is neither large nor thoroughly analyzed. 4 INTRODUCTION language facility and its state at the beginning of formal schooling. Still a third purpose is the use of the rather powerful tools of information theory in the description of informal speech over the age range, in an effort to trace the role of redundancy in shaping language as a person uses it and presumably understands it in discourse. There are several pieces of evidence that might lead to prediction of a curvilinear relationship between age and redundancy of speech. If this were supported, it could lead to the development of some interesting instructional strategies. A final but important purpose of this monograph is to present the "verbatim" transcriptions of the corpus, in both alphabetic and phonemic form, so that others, with other purposes, will be spared the arduous, expensive, and time-consuming task of collecting and editing such material.2 1.2 USES FOR TEXTS AND TABLES Although the reader will often bring with him his own different uses for the materials presented here, we shall discuss briefly some needs of a general sort for these materials. The tabular material will be discussed in order of appearance. Section & The Running Texts. These texts, alphabetic and phonemic on facing pages, represent the corpus from which all tables were derived and the basis of all statistics. The method of recording and transcribing is described more fully in Section 2: Procedures. Briefly the texts contain running dialogue from a number of peer groups of three persons in free discussion. This is considered of prime importance, since our pilot work with various techniques based on interviews and child-adult interactions yielded very impoverished language with children (vide infra), yet these techniques are widely used without comment. The transcription is sequential, just as it was recorded, from one group to the next. The texts for each of the four age groups are kept separate, however. There are more than 15,000 words at each age level and more than 1500 sentences. These can be used for many sorts of syntactic analysis of informal language; for example, tabulation of frequent syntactic patterns, use of alternative forms, sentence-depth, or right-branching versus left-branching. Theories of structural linguistics may want some revision of classes of transformations in the light of these data. Comparisons of the syntax of spoken language with formal written language are possible, as well as comparisons between the language of children and that of adults, and among dialects. We caution that the strings of sentences 1 These texts have already been used by the Southwest Regional Laboratory of the U.S. Office of Education for analysis of syntactic patterns. INTRODUCTION 5 interweave among triples of talkers and that one cannot identify an individual speaker. Indentation indicates a change of speaker, but it has not proved possible to identify all speakers accurately. These data are intended to provide reliable, quantifiable information about a homogeneous group of speakers which can serve as a norm for spoken language. Labov also claims (1968) that data of this sort are essential for development of linguistics as a behavioral science. The texts can also serve as a source of material for psycholinguistic and educational experiments. These utterances were apparently easily comprehended by peers and could be used to construct lists for testing memory, comprehension, or the effect of context appropriate for a given age. For example, comprehension of sample sentences could be compared, by means of the Cloze procedure (Taylor, 1956, 19S7; Peisach, 196S), with various of their transforms with somewhat more justification than can be summoned for sentences artificially created by adults for the purpose of testing children's comprehension. Another possibly fruitful area for those interested in speech is extent of phonemic variability within this rather homogeneous dialect. Section 7. First-order Statistical Tables. There are a number of different tables in this section with rather different potential utilities. Table 7.1 presents the frequencies and proportions of each letter in transcribed natural speech for first, third, and fifth graders, and adults. These are useful in experimental situations where high and low frequency letters are needed. These simple proportions are not very different from those derived from written texts, and neither are the several age levels very different from one another. Table 7.2 shows similar data for the phonemes of natural speech but these data are unique, since other published tabulations of phonemes have been derived from written material transcribed into a phonemic alphabet,3 not from informal discourse. This table should be useful in understanding some of the difficulties of learning to read and to spell: the most frequent phoneme in English is schwa, /»/, which is not rendered by any single letter of the alphabet, nor by any group consistently unless stress be taken into account. Table 7.3 presents the comparison of rank orders of vowel and consonant phonemes for the four age levels of informal speech. It includes, in addition, Denes' (1960) and Robert's (1965) data, both of which sets are essentially transcriptions of written language. The data based on informal speech could be useful in more accurate evaluation of the importance of acoustic confusions; for example, the biasing effects of frequency of occurrence could be taken into account. Table 7.4 presents the same data grouped according ' Sec the discussion of Table 7.S in Section 3.1. 6 INTRODUCTION to articulatory categories, by age. These tables should provide useful new data for speech research. Table 7.5 contains the correlation matrix for 22 consonant phonemes from 16 sets of data. It is useful in evaluating the differences between real speech and various kinds of other language sources. Table 7.6 presents data for relative sequential constraints, redundancy H, mean word, and mean sentence length for both letter and phonemic transcriptions of informal speech at all four ages. The growth of constraint over the first 11 pairs of symbols can be traced for each age, and comparison of child and adult language shows that very similar constraints operate. Table 7.7 presents similar data for relevant written texts, permitting a comparison with alphabetic transcriptions of speech in terms of redundancy. Per cent redundancy is seen to be a useful quantitative measure of difficulty of a text. As we have already shown (Carterette and Jones, 1965) redundancy does not depend on style and is not correlated with length of word or sentence, as many currently employed measures are. Table 7.8 presents comparative data from four levels of alphabetically transcribed natural speech and four levels of written texts of the proportional frequencies of the 26 letters of the alphabet, permitting a rough evaluation of similarities between speech and what is considered appropriate reading material at each age level. Table 7.9 shows that correlations are all remarkably high. Table 7.10 shows the relative sequential constraint in free-reading choices for three levels of children's reading material. Table 7.11 shows the effect of sample size on the various statistical measures used here. Section & Higher-order Statistical Tables. Here are presented tables of digrams (Tables 8.1.1-8.1.4) and diphones (Tables 8.2.1-8.2.4), trigrams (Tables 8.6.1-8.6.4) and triphones (Tables 8.9.1-8.9.4), for the running texts taken from each of the four age levels. They can be used in preparation of materials for verbal learning experiments, the diphones and triphones being very much more useful for auditory experiments than their letter counterparts currently in use. Until now such materials have usually been constructed from digrams and trigrams drawn from lexicons. Our data indicate that there is progressive divergence of spoken and written language as the unit of analysis becomes larger. Whereas simple proportional frequencies of single symbols are similar, differences begin to appear when higher order constraints obtain. These differences are already substantial for successive pairs of symbols. Control of language frequency in an experiment should be based on real usage. Special tables have been prepared for use by educators, although psychologists and speech specialists should find them useful also. Tables 8.3.1 and 8.3.2 give information regarding the relative frequency of word-initial and word-final letters derived from the alphabetic transcription INTRODUCTION 7 of natural speech. Tables 8.4.1 and 8.4.2 show similar data for phrase-initial and phrase-final phonemes. Table 8.5 compares the proportion of vowels and consonants in word-initial, word-final, and unspecified position for letters and phonemes. Tables 8.7 and 8.8 present those trigrams which occur in the initial position and those which occur in the final position of a word. Since the first and last parts of words carry most of the information, it was thought that tables showing frequency of occurrence of trigrams in these positions might be of especial use in preparing material for initial reading instruction or for perceptual experiments. Similar tables of word-initial and word-final tetragrams are also given (Tables 8.10 and 8.11). 2 PROCEDURES 2.1 SOURCES OF MATERIAL 2.1.1 Spoken Language 2.1.2 Written Language 2.2 TRANSCRIPTION PROCEDURES 2.2.1 Spoken Language 2.2.2 Written Language 2.3 STATISTICAL METHODS PROCEDURES 2.1 S O U R C E S O F M A T E R I A L 2.1.1 Spoken Language The few published samples of spoken language which have been collected are limited by several difficulties: small sarnple size, restricted vocabulary, formal, stressful, or otherwise constrained situations, and more particularly by poor fidelity of recording—a very important point for phonetic analysis—and are ordinarily unavailable for reanalysis; Of the four modern analyses of spoken English which concern themselves with phonology and analysis of language constraints, Denes' paper (1963), is only an analysis of two phonetic readers, Baddeley, Conrad, and Thomson's paper (1960), is based upon written British radio dialogue, Hultzen, Allen, and Miron's monograph (1964), is based upon conversation from American one-act high school plays, and Roberts' data are derived from words from a lexicon spoken in sentences. For our analysis it was desired that the sample should be sufficiently large so that any descriptive measure (with the exception of word counts, which require a vast and expensive sample) would be stable and representative. Likewise, it was important to obtain adequate language samples at several levels of language competency. The two reasonable extremes were thought to be an adult sample and a first grade (approximately 6-year olds) sample, the latter consisting of children who were just beginning to learn to read and thus have virtually no acquaintance with visual language. To have dealt with younger children would have entailed great difficulties in terms of rapport, time, and representativeness. The other two samples chosen were third and fifth graders, judged to be at such positions on the growth curve as to shed some light on the il 12 PROCEDURES development of language to adult status. The adult sample was similar to the child samples in community, national and regional origin, and socio-economic status. It was obtained from junior college classes of a city college in California. We arranged to use children from two different schools to reduce possible biases of unsuspected sorts. Both schools had children drawn largely from the middle socio-economic level. The investigation of the effect of socio-economic status on language development is an important one, but not the subject under investigation here. Moreover, it also requires a norm. It was just this norm for studies of language development of all sorts that we wished to make available. We used all children in a grade who were present when called and were not excused by reason of foreign language background, marked non-California dialect, or speech impediments. Since regions of the country differ in the phonemes used in speech, it was judged more in keeping with the aims of the study to include only one type of regional speech, which happened to be Southern Californian. Several ways of arranging a situation in which natural speech would occur were tried. First, an attempt was made to record unrestricted free speech of children among their peers in the lunchroom or on the playground. This was a complete failure acoustically because the noise exceeded the signal at all times. An attempt to record discussions in the classroom also failed because of excessive noise and poor flow of speech. Next, recordings of speech were made while individual children responded to requests to make up a story about pictures shown them. The speech was impoverished in grammatical constructions, vocabulary, rate, and even phonemes. The speech of a child when responding to requests to tell about summer vacation or what he would do during the next vacation likewise was not normal speech. Next, Strickland's method (1962) was tried. This required "props"—a group of objects on a table—and a small group (3 or 4) of children seated around it. The children were asked by the adult moderator to talk about the objects. The response was better in this situation, but even here there appeared to be restriction both of vocabulary, and grammatical forms; the normal flow of speech became halting. Finally we tried a simple social situation. Three children were seated around a small table with a young, friendly adult. The adult greeted the children by name, told them she wanted to find out what children in their grade were interested in, and asked them to talk to each other about anything they wanted to talk about. Some groups required somewhat more encouragement; if so, the adult asked a question or two: "What do you do after school?," or "How many in your family?" Thereafter she said nothing. After the initial warm-up period, which was discarded for the transcription, the speech appeared to be children's normal speech. It was rapid; there were PROCEDURES 13 interruptions; it covered every conceivable topic; it was full of slang and noise words; there was give-and-take. This, then, was the situation in which all the child speech samples were recorded. For the adults the situation was structured differently. The participants were from elementary psychology classes, so their knowledge of psychological jargon was flattered. They were told that the experiment was one in small group process and that the situation was to be completely non-directive. Then they were introduced by first names and told they were at a party. The experimenter excused himself (psychologically) to get the snacks. Again groups of three were always used. Most of the adults did not know each other, whereas in the children's group, they did. The 3-person interaction proved as useful for adults as for children, and the language produced was judged to be normal, everyday conversation, as rapid, slangy, and diverse as any in an unrecorded situation. The second major problem concerned the quality of the recording. If phoneticians were to be able to transcribe the material with any reliability, the recording had to be very good—better than any speech recordings we had heard. To this end we assembled the following high-fidelity components: (1) Ampex 1260 4-track stereophonic magnetic tape recorder and (2) 2 Altec-Lansing Model M-20 condenser microphone systems. The microphones were placed 2 feet apart, and about 8 feet from the farthest talker. New Scotch (Minnesota Manufacturing and Mining Company) l.S mil acetate magnetic tape was used. Recording was at 7.5 inches per second and each microphone fed a separate channel. Only two of the four tracks were used, giving the maximum possible channel separation, since an unused channel separated the two which were used. The cross-talk rejection ratio in the middle frequencies was much greater than 60 dB, more than adequate for our purposes. The recordings were made in the best available room at the three schools. Test tapes were made to disclose the acoustic properties of the room. Where necessary, one section of the room was draped with cloth, felt was applied to chair and table legs, microphones were adjusted and insulated. The gain of amplifiers was checked at every tape change. The microphones were always concealed from the elementary school children. To the best of our knowledge, their presence was not suspected. For the case of young adults, the microphones were in plain sight, since their presence would have been deduced in any case. After the brief warm-up period, the students lost themselves in conversation and paid no further attention to the presence of the microphones or the experimenter; in fact, it was often hard to get them to stop at the end of the period. Since the aim was to collect a sample as representative as possible of natural language, we attempted to include as many individuals and as many groups as possible, in order to reduce the effect of idiosyncracies of vocabulary, topic, sentence construction, pronunciation, and various aspects PROCEDURES 14 peculiar to spoken language. However, it was also important to allow sufficient time for each group to warm up and then become thoroughly engrossed in conversation, for otherwise many aspects of oral language suffer. We have shown (Jones and Carterette, 1963) that at least 6,000 words are necessary for stable statistical results, so the goal was set at 10,000 words per level. It was felt that more than this would require too much time for phonemic transcription, which is very slow. Well over 10,000 words per level were actually transcribed, but more material than that was collected and remains untranscribed. The number of groups and individuals represented in this analysis follows: Level 1 3 S Adults No. of Groups 18 18 16 8 No. of Individuals 54 48 48 24 The reason for the discrepancy in number of groups and individuals is the size of the sample required at each level. First graders did more giggling, interrupting, and drowning each other out, so less usable material resulted per unit time. The total number of characters transcribed is given in the following table. Total Number of Units Level 1 3 5 Adult Letters Lexical Words Phonemes A* B* A* B* 94,767 101,285 131,274 78,580 72,742 78,065 101,618 61,269 66,179 70,842 90,741 54,478 58,653 63,029 80,970 48,708 20,030 21,368 27,072 15,694 * Column A refers to total number of characters, B refers to this total with word marks (space) and sentence marks (period) removed. PROCEDURES 15 2.1.2 Written Language The sources of written language suitable for the various grades was sought first in standard reading textbooks. Readers of two widely used series were chosen as representative of material of this sort; first, third, and fifth readers were used in both series. The series were the Ginn Readers (1956, 1957), and the Sheldon Basic Readers (Allyn and Bacon, 1957). In addition, the second reader in the Ginn series was analyzed, after it appeared that the step between first and third readers was very large. All material in a given section was used with the exception of foreign words and poetry. Abbreviations were spelled out according to rules (e.g., Mr. = Mister). Any story containing a large number of foreign words was omitted. The only punctuation marks used were word and sentence mark. The exact rules are given in Section 4.1. Next, material which children like to read was sought. Wilson's Children's Catalog (West and Schor, 1961) was used as a guide because of the large number and wide distribution of the judges making the ratings. These books are rated by children's librarians from all over the country and by specialists in children's literature as books they could not do without. Each rating is accompanied by a concensus of proper grade level. We chose at random from among those books rated in the top one-ninth and assigned to kindergarten through second or third grade as our level 1, those assigned to grade 2 or 3 through 5 as our level 3, and those assigned to grades 4-6 as our level 5. At a single level we used all or part of three or four separate books, drawing equally from them to reduce the effects of idiosyncratic language, aiming at approximately 10,000-word samples. Although there is undoubtedly some adult bias in these ratings due to pedagogical urges, the ratings are also dependent upon circulation and enjoyment in "story hours." It is difficult to believe that a book which is unpopular with children could remain in the list year after year, regardless of adult bias. At least these ratings have the advantage of representing a national sample and a large one. Written material on the adult level had previously been analyzed by Newman and Waugh (1960). Their calculations were used for average adult text (William James sample) and difficult adult text (Atlantic Monthly sample),4 but for the easy adult text (the King James' Bible), we punched the same passage used by Newman and Waugh and as a test of the computer program calculated our own statistics. 4 An error in their calculation of C j | was discovered and is corrected here. 16 PROCEDURES 2.2 T R A N S C R I P T I O N PROCEDURES 2.2.1 Spoken Language Transcription of the spoken language was very difficult and time-consuming. Each tape was first transcribed by a typist, listening with binaural earphones on a research-quality playback system (Ampex Model 350-2, two channel magnetic tape-recorder). This often required many iterations. The instructions were to include all consecutive material, but if some part was incomprehensible to omit the entire utterance. Similarly, if some person was interrupted and did not pick up the thread of his utterance, the whole utterance was to be omitted, but if he did resume, then the interruption was to be omitted. The purpose of these rules was to preserve the continuous and sequentially-dependent structure of speech. It should be understood clearly that the texts preserve the order of occurrence of the speech of three peers. There was no attempt to collate the speech of a single individual. A string of phonemes from a single speaker is immediately followed by a string from another individual of the group; indentation signals change of speaker. In this way the natural sequence of meaningful discourse among several individuals is retained. Ordinary lexical words were used in these letter transcriptions to make them comparable with the written material; i.e., words were spelled properly and word marks occurred where they would normally occur in written material. However, normalized spellings were constructed for idiosyncratic words (e.g., "guy," used by many of these children as an exclamation), "noise" words (cf. Strickland) like "er," wuh," and the like. The second step was to have the letter transcriptions checked by a research assistant. This always resulted in many changes. Next the phoneticians took over. When we could get them, there were two working. Because of the volume of material, it was not feasible to have them both transcribe all the text independently. Instead we had to be content with occasional reliability checks together with subsequent ironing out of discrepancies. Two formal reliability checks were made. The number of disagreements in a passage were counted and this number was divided by the total number of phonemes in the passage. In the first instance there was six per cent discrepancy in 2300 phonemes transcribed. In subsequent discussion, agreement was reached. This involved listening together to the taped passage and evolving new rules for transcription. Examples of these rules are: (1) Don't use schwa if you can hear the quality of the vowel; (2) If the sound is genuinely between a "t" and a "d," use the one which is normal for the word. A second check revealed a still greater discrepancy, sixteen per cent PROCEDURES 17 (1800 phonemes). Much of this was due to insistence by the authors that the transcription be as phonetic as possible within the bounds of the phonemic alphabet. Since the phoneticians were not used to this procedure, and also had used different systems in the past, some learning was necessary. The intent, with which everyone concurred, was to represent all the variations possible within the alphabets used. There were three very good reasons for not attempting a phonetic transcription: (1) the programming would have been more difficult, (2) the transcriptions would have been very much less reliable, and (3) the import of speech seems to be much better rendered by the phonemic transcription since this is presumably based upon the contrastive features of the language (Daniel Jones, 1962). The phonetic use of the phonemic alphabet with children was intended to permit discovery of lesser redundancy in young children due to inconsistency in pronunciation, if this existed. As an aside we should like to point out that apparently most so-called phonemic transcriptions of an individual's speech that appear in the linguistic literature are really pseudo-phonetic transcriptions like ours. That is, a standard phonemic alphabet is used to represent the phonetic character of the speech, but the contrastive analysis necessary to establish his phonemic system is never undertaken. We shall hereafter refer to our analysis as phonemic, with the understanding that it is not technically a fully phonemic one. The problems of reliability of transcription were dealt with as effectively as possible under the constraints of time and availability of phoneticians. Phonetics is not an area in which Linguistics students in America are highly trained. It is therefore difficult to hire phoneticians with any but minimum experience. The turnover was likewise high, with long periods of vacancies and retraining. Four phoneticians participated in the final transcriptions and all were interested enough in the project to give it more than mere duty required. There was free interchange and discussion between the members of each pair and some interchange across pairs. The phoneticians placed "word marks" only where there were brief pauses. Instructions were to not make printed words a guide, but to indicate only breaks in the flow of speech. The placement of sentence marks became a very difficult problem. Since a good deal of the material was agrammatical, the use of a grammatical criterion was deemed inappropriate, because it might conceal any unusual implications of the data. An attempt was made to use tentative pause and final pause, but the two phoneticians could not assign the first of these reliably, so it was abandoned. The terminal juncture was placed by the phoneticians and was used whenever an utterance was terminated by a change of speaker or when there was a clear pause of a type the phoneticians were willing to call terminal, judging largely by intonation contours and appreciable silence. The reliability was not high for this aspect of the transcription. Detailed transcription rules are given in Section 4.1. 18 PROCEDURES The purpose of these rules was to permit generation of hypotheses about the natural units of language, since it became immediately obvious upon listening to the tapes that the language was quite different from linguistically ideal or written language. The 41-character alphabet used is presented in Section 4.3.1. There are 39 phonemes, 14 vowel and 25 consonant phonemes, plus word mark and sentence mark. The system used is basically the Trager-Smith system (1951), with some modifications suggested by Professor Peter Ladefoged for this study. The phonemic transcriptions were coded into an alphabet accepted by Fortran programs, checked, and key-punched. 2.2.2 Written Language Since ordinary alphabetic characters are acceptable to the Fortran program to be used in the statistical analysis, transcription of the written material consisted in key-punching directly from the text, according to the rules given in Section 4.1. Once punched, these were proof-read by two people, corrections made, and the corrections proofed. The original keypuncher did not proof her own work alone. 2.3 S T A T I S T I C A L METHODS A program for computing the sequential constraints of chains of symbols (i.e., letters, phonemes, words, grammatical forms) was written for the IBM 7094 computer. The program computed measures of information and redundancy on a printed "language" each of whose symbols was represented as an arbitrary symbol of the Fortran alphabet. The measure of information, as estimate of the Shannon-Wiener measure of selective information (Shannon, 1951), was printed out along with an adjustment for bias due to sample size (Miller and Madow, 1954). Contingency tables were constructed showing the number of times each character was followed by every other character, both immediately and at lags of 2,3 11, 29, 59, and 119. From these contingency tables, /?„ the information associated with this o-state stationary Markov chain, was computed from HT = - S P(i)P u log ! 1 P 1 J , (l) where P(i) is the absolute probability of being in state / and P{j is the stationary transition probability of going to state yon the (n + l)-th trial after being in state / on the n-th. The relative sequential constraint on the second PROCEDURES 19 pair of characters when it is the n-th member of a sequence n characters long (in which the first character of the pair is the first member of the sequence) is defined as Cn and is given by «-» Y. f f t (1:2) C (2) • " '"dL»pj The contingent uncertainty Hk (1:2) is defined by Hk (1:2) = H(l) - Hj(k), (3) where the first term of the right side of the equation is the uncertainty without sequential dependency,.i.e., the average amount of information in each letter, )_a H(l)= - E P(i)logtP(i). (4) i-i P(i) is the probability of the i-th symbol's occurrence, and a is the number of symbols in the alphabet. Hr(k) is the Markovian information ^t lag k. It is formally identical with Equation (1). The index k specifies the forward distance of the transition from symbol / to symbol j. Thus, C2 gives the relative sequential constraint on the second of a pair of characters in which the second character is contiguous to the first; C3 gives the relative sequential constraint of the second of a pair in which the second is separated from the first by one character; and so on. Equation (2) makes the subscript of C(that is, n) equal to the lag plus one. We used k's of 1,2, ..., 11, 29, 59, and 119, which yielded the constraints between all pairs of characters in which the second was at the designated step to the right of the first. For a discussion of the restrictions on these computations, see Garner (1962, p. 213 if) and Edwards (1962). Finally, mean word-length and mean sentence-length for each text were calculated. 5 An estimate, IT, of H unbiased to terms of order 1/ti1, (Miller and Madow, 19S4), was used: \= * + * fir + m\ where a is the alphabet size, and n is the sequence length in symbols. H is, of course, the estimate of the theoretical quantity H, and is found from Hi) = j and A, = f f The quantity / refers to the frequency of being in state / on trial j; whereas ' This schematic development and the equations given are different from those of our earlier papers (Carterette and Jones, 1963, Jones and Carterette, 1963; see also Newman and Waugh, 1960). We are dealing specifically with pairwise sequences of symbols that form a Markov chain and not, as ouF«earlier equations wrongly implied, with pairs formed by sampling from a bivariate distribution. However, the earlier equations and those of the present paper lead to identical numerical results. For an interesting discussion of the different assumptions underlying the two sets of equations, see Binder and Wolin (1964). (5) 20 PROCEDURES /¡j refers to the frequency of transitions from state / on trial s to state j on trial (s+1). Both estimates /find H were computed for each P^ and P(i). Apparently the sample sizes used were sufficiently large to give stability, for H and /differed by only a few thousandths of a bit at most. No attempt has been made to make statistical tests between the various redundancy functions, e.g., whether the redundancy functions for first and third grade natural speech are different.6 In view of the correlations among the various constraint measures, it is not clear how tests should be made. We point out, however, that the functions are very stable, and there is but one instance of a crossing of two functions which were in any event very similar to begin with. The first-order statistical tables are in most cases by-products of the analysis of sequential constraints. Where relative frequencies are concerned, the statistical assessment has been by means of r, the Pearson product-moment correlation coefficient, or a /-test. Standard methods were used to test the significance of changes in proportion of letters of phonemes between age levels (Hoel, 1965). Special programs were written for the tabulation of letter and phonemic digrams, trigrams, word-initial and word-final trigrams, and tetragrams. Only elementary descriptive statistics are given for these. * For a basic discussion of testing hypotheses based on information measures, see S. Kullback (1959). 3 DISCUSSION OF THE STATISTICAL TABLES 3.1 DISCUSSION OF FIRST-ORDER TABLES 3.2 DISCUSSION OF HIGHER-ORDER TABLES 3.3 FIGURES Figure 3.3.1 Relative Sequential Constraint in Letter and Phonemic Transcriptions of the Speech of First Graders and Adult and in a First Reader Figure 3.3.2 Relative Sequential Constraint for Several Written Texts Figure 3.3.3 Frequency Distribution of Letters from Adult Speech and Adult Text Figure 3.3.4 Relative Sequential Constraint in Three Levels of Children's Free-reading Choices DISCUSSION TABLES OF THE STATISTICAL 3.1 DISCUSSION OF F I R S T - O R D E R TABLES Table 7.1 shows the frequency and proportion of each character of the alphabet in the letter transcriptions of natural speech. There is very little change in the frequency of occurrence of letters across ages (see Table 3.1.A). The largest change is in m which decreases steadily from first grade to adult speech. It is partly accounted for by a decrease in the use of "urn" as a noise word, with the comcomitant rise in the use of "you know". The same comment applies to the increase in y from first grade to adult speech. 23 24 DISCUSSION OF THE STATISTICAL TABLES TABLE 3.1. A Tests of Significance of Differences Between Certain Letter Frequencies* Letter Groupt Compared t e 1st Grade vs. Adult 1.7 - t 1st Grade vs. Adult 2.1 .02 a 1st Grade vs. Adult 3.9 .01 o 1st Grade vs. Adult 4.2 .01 m P landa. wiys£d h£ygraema. w£lwiys£? wiykolarbayarfarstnfym wamwiyjudn? wiys£? h£ylowla wetaepntuwarp bfdruwm. JiysEd ?oww ?akaetsbinin&£r. ?aymiy? Jiys£d ?am ftErwez&is yanow prawlar. prawlfr. watsaprawl£r. sambayhuwgowzarawnd startsstiyltq lukiqinsambadiyzwindow. laykyuw. ?am lukiqinsambadiyzwindow samtaymz samtaymz &£ykamarawn siyam piypalandrEsiqfarbEd bEdtaym. wElmaymamiyhaedagow&ahaspital. biykas Jiy? /iyhysdap£yninarsaydn6£n?am n6Eyhaedat£yk£ksr£yz. ?aen ?ayst£ydowvaratmaygarlfr£nzhawsnmaydadiy hiygowstawarksa? ?ayhaefta st£yat?am paetiyaenzhaws ?aenl£smaymamiy ?aen bat/iyzkamiqhowmtadEyaenif Jiy?e ?izhowmon wEnaygEthowmwal&Enaykangowhowm. ?aenyanow ?emay ftEyrz&ts ?in maykazanjiyz Jiysdamuwvawfyframhiyrbiykaz ?am ?i?waztuw?a ?i?wastuwnsyziy sow/iymuwvtuwah sowjiymuwvtuwahhowmtawn. ?aenft£n ?sn&£njiy?am s£n?miya naw?a &£n?am ?a Jiys£n?miyal£tar njiywaznayn ?inharbart)d£y. Paendsow JiywazEyt naw/iyz ?ay nayn ?aen?am ?aymstil£ytnowbra&ar. ?aym£ytuw. Payaemtuw. yuwriyliyarnt. yfsayaem. maykalruwbanzfyt. maykalruwbansEvennahaf. maykalruwbanizEyt. maybart)d£ywazrayt3n6abar6d£yhizwaz. Paenwiyso&is PaenriymEmber wEnwiysaftaetpikJarabawPftaet ?am wanfiqgar/ark. nowwayiygatiznEym. wenfiqerjark watpik/ar. ?inhiyrarin Paditsnyam. ?aditoriyem. ynowhawiygatiznfym. 206 THIRD GRADE Well I have a dancing lesson and I go to Bluebirds and I play color things like that. Read books. Ride my bike. Help my mother with the dishes. Oh when I get home from school I have to do some work around the house take down the trash and sometimes my sister has to help me with the dishes. And um she has to um wash them I have to dry them. And then um after I do my work I can go to the playground then I play handball sockball tetherball. Then when I get home. We play around. Usually I play hopscotch with my friend. And sometimes I play guns. Sometimes I get into rock fights. And uh and then uh I eat dinner. And thats about it. There just one thing wrong about I dont like it. I dont like the rock fights. Thats a good way to get a black eye. She did it. Yes. Me and my friend were playing handball and she came along throw a rock at me. Well when I get home I play with my friend and then I go in the house and help my mother with the dishes and I empty the trash and um then my sister comes out with me and we play ball ride our bikes. And then we go in and eat dinner and we wash and dry the dishes. Then we watch tee vee. I wash them and dry them every night and I take out the wastebaskets. I have to clean my room though. Thats bad. Every morning when I get up I have to make my bed. And do the dishes. I like to make models. I have um one model of the wolfman one model of Dracula and one model of Frankenstein. And I have two ships. One is in Arizona. One is the um fifty three um hims. Or something like that. Well um then I like to paint them. I just got this new model its a spitfire. Um just get them in this box and then buy some glue and put them together. I make dolls out of yarn. I dont. I dont like your brother very much. He comes along he gets this ball so he he acts like Im playing dodgeball you know. He starts throwing balls at me. Guy know once he had this volley so it hit right on my head and I ducked just in time. One time I was playing baseball so um I was the pitcher so I pitched it to your brother you know and he hit the ball right over my head. We were playing darts and he just went like that. He got the dart caught in my hair. Why dont you start something. You can say that again. Like you spit on me yesterday. Yeah. Gosh you really did get me mad. When I was in my bedroom with my sister she threw uh um a plastic bowling ball at me. And she was throwing it. And she threw it right at my feet and I jumped and she missed me. Oh I like the sound of those birds. But theres just one thing wrong with them. I dont like them. Um I saw this movie of the birds you know. These birds they come and pick out your eyeballs. Know this know in the movie INFORMAL SPEECH 207 hiybaytsofwenfiogeraetataym. w£l ay haevedaensirjlEsen Paenaygowtabluwbardz ?£n ?aypl£y kalar 9iQzlayk6aet. riybuks. raydmaybayk. hElpmayma&arwiOadiJaz. ?ow anayg£thowmfremskuwlay Paeftaduwsamwarkarawnftahaws teykdawn&atrxj aen samtamzmaysisteaesta hElpmiywiGadijiz. PaenPam Jiyhaesa Pamwajammaeaeftadrayam. Paendfn Pamaeftarayduwmaywark kaykeogowtadaplEygrawndEnayplEy haenbol sakbol Uftarbol. ftEwanaygEt howm. w a p l t y a r a w n d . yuwslayplEyhapskaCwiGmayfrEnd. PansamtaymzayplEyganz samtaymzayg£tintarakfay?ts. PaenPa Pan&En ?a ?ayiy?diner. Pan ftaetsabawdit ftfrJistwanOiq ratjabawdaydownPlaykiP. PaydownPlayk&araksfayPts. ?a?tsaguw£ytagitablaekay. JiydidiPt. y£s. miyanmayfrfnwuplEyanhaenbolan JiykEymelor) GrowarakaePmiy. wowwEnaygEthowm ayplEyiOmayfrEn Pan ftEnaygowan&ahaws sEnhEPpmayma&ar wi&adijazanay PEmptiy&atraeaJ Jan ?am 6£n maysistarkamzawPwiGmiyanwiyplEybol raydarbayks. PandEnwiygowinanniyPdinaranwiy w a j Jandray&adiJaz. dEnwiywafitiyviy. a y w o / a m a n d r a y a m EvriynayPtanaytEykawtftawEysbaeskits. Paeftakliynmayruwm&ow. ftaetsbEad. EvriymorniqenaygEdap ayaeftam£ykmayb£d. anduw&adijtz. aylaykdamEyPkmadalz. Pahaev Pam wanmadalavftawufmaen wanmadalavdaraekyale Enwanmadalavfraenkinstayn. PEnayhaevtuwJips. wenizinaerizowna. wanaz&aPam fiftiyOriy Pam himz. orsemGinlayk&aeP. waPam &£naylayktap£ynam. PayJisgaP&isnuwmadalaPtsaspiPtfayar. am lusgEdumandisbaks sinbEn baysamgluw PEnpudumtagE&ar. PaymEyPkdalz awdayarn. aydownP. aydownPlaykyerbra&arvariymai. hiykamzalar) hiyg£?tsdisbal soVviy hiyaeslaykamplEyindaJbalyanow. hiysatsGrowinbalzaePmty. gay now w a n s hiyhaeP&isvaliy sowithitratammiyhEdanniydakt Jestintaym. wantaymayazplEyinbEysbal sowPam Paywaz&apifiar sowaypidtittayarbrafeeryenow EniyhiPt&abal raytowvamayhEd. wiywarplEyindartssin hiyjistw£n?layk&ae?t. higa?ftedar?£a?tinmayh£ar. waydanPduwstartsamGiQ. yuwgunsEy&aetagEn. laykyuwspidamiyyEstardEy. y£a. g a j yariyliydigiPmiymaed. wenayuzinmaybEdruwmwaftmaysistar JiyGruwPa Pa Pa plaestakbowliQbolaePmiy. ?£n Jiyaz&rowanat. p£n/iy6ruwi?raytae?mayfiyd£nayjamptinjiymistmiy. owaylayk&asawnav&ozbards. batftarzJistwenGiQraQwiGem. aydownPlayk&Pam. Pamaysa&ismuwviyavdabardCyinow. ftiyzbardz 6£ykamempikaw?yeraybalz. now&is now in&amuwviy 208 THIRD GRADE this guy hes just sitting without um withone eyeball out. With blood all over his eye and this one buy just standing there so I said smile youre on candid camera. Well on Saturday we watch horror movies. I do too. My mom doesnt like them. My dad just loves them. My dad dad does too. My mom comes in and reads. Theres just one thing wrong that I dont like about Saturday night. What. I dont like to watch those doggone fights. And every night my dad he turns on seven watches it and then we watch a army picture. Its on every Saturday. Sunday we have to watch um pictures and things like that. My sister wants to watch Lassie and the Jetsons. Know what know what I saw on the birds. See I saw this um I saw it six times the birds. So um on Easter Sunday um I saw it for my sixth time oh guyMy dog he uh he um every time he gets his ball he pushes it in front of me. Then if I dont kick it he he picks it up and he he cuts he chews the ball in half and theres half and half on each side and he puts it on his mouth and its half is over his nose and half of its in his mouth and he looks like hes got a great big blue monster nose. He takes his football and chews it apart too. I had a little uh doll coat outside. Um and Ginger he tore it. Um. He tore it apart. Whos Ginger. My dog. I thought it was Gingerbread. I would eat it. My brother named him that not me. My dog everytime I go in the house he jumps on me and pulls at my clothes. Nicky I think. And I know why you um named him that. Because he was born on Christmas. And you got the idea from Saint Nicholas. So you call him Nicky. Remember what happened on April Fools we put that centipede on the teachers desk. She was in the corridor. She goes in the corner. You know what uh I got um I got ten of those centipedes. I got four grasshoppers. Nine snakes. Are there grasshoppers. Yeah. Theres grasshoppers four frogs. Spiders. No. INFORMAL SPEECH 209 ftisgay hiyzJissitiQwi8aw? ?amwi8wan ayballauPt. wiBbladalowvarazayan&iswanbayJisstaenden&Er sowaysedsmaysl yarankaendidksmra. wEl ansaedardiywiywaChararmuwviyz. ?ayduwtuw. maymamdazanlaykam. maydaedjistlavzam. maydx? daeddaztuw. maymam kemz iinenriydz. &ara2iswan0iqraQ6aetaydown?laykebaw?tsaederdCynayt. W9?. aydown?tlaykdawa&6owzdaganfayts. PcnEvriynaytmaydaed hiytarnzanscvan wa£azi? ?end£nwiywa£a?arnruypi£ar tsanevriysaedardiy. sand£ywiyhaeftewa£?am pikCarzinOiqzlayk&ae?! maysistar wantstawafilansiy an6aj£?tsinz. nowwa? nowwadaysae an&abardz. siyaysa&is ?am aysai? sikstaymz debard. sow ?am ?aniysarsandcy ?emaysai?fDrmaysikstaym owgay. may dag hiy?uh hiy?em ivriytaymiygi?tsizbaliypujizi?infrenavmiy. &£nifaydown?kikidiy hiypiksidapanPhi hiykets hiy£uwz&ab3lanhaefanarzhaefenhaefaniy£saydeniyputseaniz maw9eni?s hatfizowvariznowzenh«favi?sinizmaw6£niylukslayk hiyzfadagreybigbluwmansternowz. hiytEyksizfutbolen£uwzidapar?ttuw. ayhsdalidal?ah dalkowtawtsayd. ?em aenjinjarhiytarit. ?am. hiytoridapart. huwzlinjar. maydog. ayeodiwezjinjerbrid. ayadiydi?. maybra&arn£ymdim&ae?t na?miy. maydagcvriytaymaydgowin&ahaws lyjempsammiy an puwzae?mayklowz. nikiyaySiQk. anaynowwayyuw ?am ntymdimftae?. biykaziyiz bornankrismis. enyuwga?&iyaydiyafams£yn?nikalis siyakolimnikiy. r£barwathaepindan£y?prafuwzwipu?t&ae?s£nipiydan&atiy£erzd£sk. Jiywazin&akarider. jiygow?in6akerner. yanowwa?ta ayga?t?am aygatcnav&owzscnipiyz. aygatforgrashaparz. naynsncyks. er&argraeshaparz. yea. zgraeshaparz forfragz. spaydarz. now. 210 THIRD GRADE Mouses. Yeah. Three mice. And I got six um spiders. Oh I got a whole mess of them. I got one spider and two mouses. I got one spider one frog two centipedes um and I got three mice. My sister has a white mouse. I got four. I got um all three of mine are um black mice. Now I got four um four of these little skeletons. Oh. I gave mine to Dick. Because I didnt like it. Know what I did to my mom when you first gave me that one um worm. Well um I told my mom hey look mom I found a worm. She says take it away take it away. And my brother and the spider um I said mom. I put it on the wall you know and my mom comes you know shes excited so she opened up the cupboard door. And she goes and she screams. And my dad comes running in she says. How did she scream. Real loud. Come on. Tell me. Yeah. Real loud. Like how. Once I put this spider I um I tied a string to to the body and then I hung it up and and on the um on the light thing I took a chair and hung it up on light thing and she screamed when she saw it she thought it was making a spider web in the house. Couldnt she tell that that was rope. It was white string. Know what I um did to this one boy. When we had a rock fight you know. Um I got this one little um three bolts. So I put solder in one of them. So then um well first I put a string um around all three of them. Then I put solder in them. And then um no. First I glued um all of the um bolts together. Then I got some solder and I put it in them. And well the and string was um string was just on one of them. So I swinged it around and around and around like this. So I threw it and then I hit the guy right here in the leg. And then once um at my friends house um um um I got this hose you know we were having a water fight. This guy he was coming around with two water balloons balloons in his hand. One was about that big. He was just about to throw it at me when I when I said honor and started shhh squirting him and everything. He had glasses on too. I have to dust the den. And so then he starts walking home soaked and everything. That was funny. Yeah she lives right next door from me. Guy I have so many rocks fights. INFORMAL SPEECH 211 mawsiz. yce Oriymays. enayga?siks ?em spayderz. owaygaahowmfsavam. ayga?wenspayd£rentuwmawsiz. ayga?wanspayder wanfrag tuwsEnipiydz ?em ?aend ?ayga?t8nymays. maysistarhaezaway?maws. ayga? for. ayga? ?em ol8riyavmaynar ?em blaykmays. nawayga? for ?em forev&iyzlialskEletinz. ow. ?aygcyvmayntedik. kazaydidanlaykit. now8dayditemaymamw£nyuwfarsg£ymiy&s?wen?am warmwal?eh ?aytowlmaymam hey lukmamayfawnawerm. Jez tEykiwEy tcyktdewcy. anmaybra&eran&espaydartem aysidmam. aypudidan&awalyana ?aen maymamkemz yanaJiyzEksaydidsajaowpindap&ekabarddar. ?£n/igowz anjiyskriymz. anmaydae?kamzrananinjiys£z. hawdidjiys£nym. riyllawd. kman. tElmiy. yea. riyllawd. laykhaw. wunsayputdisspayder ?ay?am ?aytaydastriQtuw te6ebadiy£n&£nayheijidepen Enan6e?em an&alayP&iqaytukaCEran haijidapanlayP&iQenjiyskriymdwan/iysaetJiy&adiwez m£ykiQ8spayarw£ban&ahaws. ku?ntJiyt£l&8t&ae?twazrowp. ?iwazway?striq. nowwaday ?am didte&iswanbay. wanwiyaedarakfay? yenow. ?am ?ayga?t&iswanlul ?am 6riybolts. sowaypatsaderinwanavam. sow&En ?em wafarstaypudastriq ?am arawnalGriyavam. ftinayputsadarinam. ?aen&£n 7am now. farstaygluwd ?am?alav&a ?ambaltstag£&ar. &£nayga?tsamsadaranaypudi?tinam. ?aen? wal&a? snstriqwaz ?em striQwezJistanwenevam. sowayswiqdidarawnenerawndanarawnlayk&is. sowayOruwidan Enayhit&agayraythiyrin?&al£yg. a&£nwens?em ?ae?mayfr£nzhaws ?am ?em ?am ?ayga?t&ishowzyanowwiyarhaevtq Pawadarfayt. &isgayhiyazkumnarawnwa8tuwwadar bauwnz baluwmziruzhaerr. w£nwazabaw?&ae?big. hiyazIistabawta&owidaw?miyw£nay w£nays£d ?aneranstardi skwerdanamanEvriyOiQ. hiyhae?glaesizantuw. ?ayhaeftadast&id£n. ?£n sow&£niystar?tswakiqhowmsowkt anEvriyOir). aeazfaniy. y£a ;iylivzray?n£kstorfremiy. gayayavsowmeniyraksfayts. 212 THIRD GRADE Yeah and you take the rocks from our place. I know from the front. Well I dont I find them in the alley from you throwing them. Throw them at me I pick them up and I throw them right back. Whats that supposed to be. Cant you do it. What. Sure. I can do it. Thats wrong. Gail thats wrong. Looks like a flower starts going in you know. Look at Gail. Count my fingers. You have blocks in your head. All girls have them. Naturally. All boys are made out of snakes and snails and puppy dog tails. I have one brother. I have two brothers and two sisters. I have one brother. One father. One mother. Two grandmothers. One grandfather. And lots of aunts. And one aunt. I have three of them. Guy you know Paula. She always goes in front. I think Lisa doesnt like this school. Because every time uh every few minutes she starts to bawl. Guy you know this girl named Janice. Well um just because um this girl this other girl put a play bug um down her dress she starts crying. Guy. Why did the robber take a bath. Want to get a clean get away. Right. How did you know. Why do you wear glasses. Because Im farsighted. At my other school well uh there were a lot of kids absent. You know how many we had in the room. Only seven. Because most of them had the measles and chicken pox and mumps and I was absent only for one day. A lot of them. And I have to get here by eight thirty. So. Eight thirty. I have to get up at seven oclock. So do I every morning. I have to get up at six thirty. Why. Mother goes to work at seven thirty. Last night when I we went to this um womans house her um my my friend Pat. Her uh sister. Well we went out over her house and we stayed there until eleven oclock so I was so my mother she got so mad at me this INFORMAL SPEECH 213 yta aiyuwtcyk&araksfremarplcys. aynov fremdefrent. walaydowntayfaynamindiyaelty fremyowflrowiQnem. OrowanjPmiyay pikamap anay6rowamray?baek. wasasapowztabiy. kan&wduwi?. wat er, aykinduwit. ?at80Q. gtyl 6ae?tsraq. lukstyka flawarstartsgowiqinyanow. Iuki7|tyl. kawtfmayfiQgarz. yuwhaeblaksinyuwrhcd. algarlzhaevam. nae£araliy. olbayarmcydawdasncyksansncylzenpapiydagtcylz. ?ayhsvwan braftar. ?ayatuw bra&arzantuwsistarz. ayawan bra&ar. wanfa&ar. wanma&er. tuwgraema&arz. wangraemfa&ar. ?anclatsavaents. aenmnaent. ayhavOriyavam. gay anowpala Jiyowiyzgowzinfrant. ayOifcliyzaduzinlayk&isskuwl, biykaz Cviytaym ?e Eviyfyuwminisjiystartstabal. g«y 'enowftisgarlnEymdJasnis. w£l?am Jasbiykaz ?am ftisgarl ftisa&argarlpu? apleyba* ?sm dawnhardrcs Jiystartskrayiq. gay. waydid&erabert£ykabae8. warHJidekliyngidewEy. rayt.hawadyuwnow. wayuwyuwwcrglssiz. biylozaymfarsaydid. ?a?tt>aye&erskuwl wal Pa&crwaraladakidzaebsin. yuwnowawmtniywiyhaed in&aruwn. owniyscvin. kozmowstevemhaed&emiyzalzenCiktnpaksonmampsen ?aywazebsinowniyforwendty. eladavem. ?anarhaeftag£?thiyrbay£y?8ardiy. sow ?£y?8ardiy. ayaeflegedapx?ts£vineklak. •oWciway EvriymorniQ. ayhtftag£dapaetsiks8ardiy. way ma&rgowzdawarka?s£vin8ardiy. Iasny?t wcnay wiywtn?tta&is ?amwumanzhaws har ?ammay mayfrcnpaet. har ?Mittar wawiywcnow? ?owvarharhawsaem wiyst£yd£rantiliyl£vinklaksow aywazsw mayma&ar 214 THIRD GRADE morning. Last night well she said. When you get in the house go right straight to bed. We didnt. Last night we were supposed to put up the um take out the trash can. So she got mad at uh us about that. I told her mommy you told us to go right straight to bed so we did. So I forgot to make my lunch this morning. Yeah I had some lunch. Pat gave it to me. My friend. He doesnt have any lunch then. Is your mother divorced. Do you have a father. Yeah. In your own house I mean. No. How can your father be your father if hes divorced. Hes still our father. Well that doesnt mean the that means that theyre not married anymore. So theyre still still my father. When uh when we were in school remember the teacher said that she was going to tell us about things. Hey theres another film. Ooo theres the sound. Whats so funny Janell. Lets see. At least thats something to talk about. Well when I go someplace real when I go someplace real late well um I get tired so I say lets go home. And then and then um and then in the car I Im real wide awake and I say I dont want to go to bed. And um. Um once I went to this girls house to stay over and um I wanted to go home because I didnt like it and um so I went home and I said Mommy why did you take me home I want to go back there. And then I was at my cousins and I wanted to go home. And then I went to my cousins and um I wanted to go home and just as my and just as my mother and father got there I went to sleep. When I was at my cousins at Long Beach I said Jamey and I went fee fie foe fum. I smell the blood of Jamies. And he used to get real mad and say Janell now you stop that before I tell aunt my mama. Aunt I mean my mama. You talk about something Craig. Oh gosh. Did you see Michael Rubin um hit the ball. No. I did. Guy he socks it real good. Yeah I socked it over Ricky Searles house and then Steve goes whee and he drops it. Then Michael Rubin gets out. Steve tapped it. Everytime that I go to Lisas house next door well she um you know her house is hooked to my house but its apartment. It is. INFORMAL SPEECH 215 Jiyga?sowmx9?miy&8sm3rnin. laesnay? wajiys£?d. wanyuwgEdin&ahaws gowray?tstr£y?deb£d. wiydidan. laesnay? wiywarsapowztapsdspds ?amtEykaw?t&8 traefkaen. sowJiyga?maedaede asebaw?t&ae?. aytowldar mamiy yuwtowldastagowray?tstr£y?tebcdsowiydid. sowayf9rga?t8m£y?kmaylenCismorniQ. y£ayhaedsemlen£. pae?tg£yvi?tuwmiy. mayfrEnd. hiyduzenhaevfniylanC&En. izyarma&ardiyvorst. dayuwhaevefaftar. yae. inyerownhaws aymiyn. now. hawkenysrfa&arbiyyarfaftar ifhiyzdivorst. hastilarfaftar. wai&aePdazanmiyn&a 6aB?mtynz6ae?ft£rna?maeriyd£niymor. sow ftarsti? stilmayfa&ar. w£n?a wEnwtywarinskuwl riymEmbar&atiytarsEdatfiywazganatElasabawPSiQZ. hey ftErzanadarfilm. uw ftarzesawn. wasowfaniyJanEl. l£?tsiy. ?s?liys6ae?tsem6in&at3kebaw?. wsl wEn?aygowsampl£ys nyl wfn aygowsempl£ysriyll£y?t w£l ?em ?ayg£?tayerdsoways£yl£tsgowhawm. aen&Enaen6En?am ?an&£n Pin&akaray ?emriylwaydew£ykanays£y ?aydowanagowdeb£d. ?aen ?em. ?em wans ayw£n?te6isgarlzhawsdast£y?owv£r ?aen ?am aywandtagowhowm biykazaydinlaykit ?aen ?em sow aywEnthowmaenaysEdmamiy waydadyuwtEykmiyhowmaywenagowbaek&Er. aend&En aywazae? may ¿azinzaenaywanadtagowhowm. ?aen&£nayw£n?temaykezenz ?aen?am Paywentagowhowm ?aenjesezmay? Paenjastazmayma&arenfa&ar ga?t&£rayw£n?tasliyp. enayw8zae?tmaykez8nzae?tloQbiyC ays£d Jfymty ?aenayw£n?t fiy fay fow fern. aysm£l&e bledav J£ymiyz. aeniyyusdegi?nylmaedense ¡en£lnawyuwstapftae?biyforayt£l ?aen? maymama. ?aen? aymiynmaymama. yuwtakabawPtsam&iQkrEyg. owgaj. didyuwsiymaykalruwban ?emhi?6abol. now. ?aydid. gay hiysaksid riylgud. yEaysaktidowvarrikiysiralzhaws Pen&En stiyvgowz wiy eniydrowpsi?. &Enmaykalruwbingitsawt. stiyvtaePpdit. Evriytaym&aedaygowta liyzazhawsnEkstor wa/i? ?em yanowherhawsizhukte mayhawsbet ?i?tsapar?mint adiz. 216 THIRD GRADE Well no wonder. Anyway. Well anytime that I want to go home she says come on Janell just uh about ten more minutes. I says okay but its going to be fifteen. Okay. And she says no fifteen. I said no five you said first. She says no ten. I said one. She keeps on going higher higher higher high. Craig do you like Elise. Whose Elise. Elise Rowe. Elise Rowe who. You know. Come on. Do you like her. You know her I know. I know. I guess. You know what she did she stole a candy bar from the store. She stole the candy bar from the store. Candybar what kind. Any kind that in the store dont you know. Theres lots of them. Once when I was small about four or five years four or five years old. This is like girl talk only boys and girls talk. And I I um I took a spoon and I like um peanut plain peanut butter on a spoon. So I got some on this spoon and one night when I was licking it like a ice cream bar. I was just licking it like that. I saw this squirrel come down. So I bend down and I let the uh squirrel uh have some um peanut butter so when it was all gone I went back in the house and got some more. What about germs from you. How much longer do we have to talk. Yeah. It looked like it was fifteen after in our room. Fifteen after in our room. I know it but when um sometimes they talk here. So. Who. Missus Endicott. Whos she. Shes the teacher that taught here. One more minute. I never have seen her before. You never seen her. One day when um I had my birthday we went to uh uh Disneyland and came back had dinner went to a movie and then uh went to another drive in. And then the next day we got with out cousins and went up to the snow. And we had a uh a lot of fun. The snow was uh real cold and uh if you put it um. Yeah yeah we threw snowballs and well one landed on my uh face and uh I took my shirt off and went in a a tent um got the uh campfire INFORMAL SPEECH 217 wElnowwendsr. ?£niyw£y. wEl PEniytaym&aedaywenagowhowmJiysEz ksman]an£l Jes ?a bawPumorminats ?ays£z owk£y baiPtsganabiyfiftiyn. owk£?. Pcn/iysEz now fiftiyn. aysfdnowfayv yuwstdferst. JiysEz nowt£n. ayscdwan. Jiykiypsaqgoinhayarhayarhayarhay. krtag deyuwlaykiyliys. huwzaliys. aliysrow. eliysrowhuw. yuwnow. kaman. dayalaykar. yanowar aynow. aynow. aygfs. yanowatjiydid Jiystowleksendiybarfram&astor. JiystowdakaendiybarframnastDr. kaendiybar wa?kaynd. EruykaynbsPsin&astor downiuwnow. &arzla?tsavam. wenswEnaywezsmalebawPforarfayvyiyrz forarfayvyirzowd. ftisizlaykgarltokowniyboyzangerlztok. ?£nay Pay ?am Paytukespuwn anaylayk Pampiyna plEynpiynaPbadar Panaspuwn. sowaygaPssman fttsspa? anwsnnaywanaywazlikinid laykaayskriymbar. Paywaz JislikiniPt layk&ae. ayso&isskwerlkemdawn. sowayb£nd dawn£nayl£t&a Paskwarl Pahaesem PampiynaPbadar sow wEruPwazolganaywEnPbaek in&ehawsangaPsammor. wadabawPjarmzframyuw. hawmaClarjgerduwwiyhaevtatDk. y£a. iPluktlaykiPwazfiftiynaeftarinarruwm. fiftiynaefterinarruwm. aynowat baPwin Pam samtaymzzEytokhiyr. sow. huw. misazEndiygaPt. huwjiy. Jiyz&atiyCer&EPtathiyr. wanmorminat. PaynEverhaevsiynarbiyfor. yuwn£varsiynar. wandEywEnPam ayhaedmaybart)d£ywiywEntuw?e adizniylsn PenkEymbxkhaedinar wantaemuwviy in&En?a wEntaanefterdrayvin. tn&in&anEksdfywiygat wi&arkezinzinwEnapta&asnow. inwiyhaeda Paaladafan. ftasnowazPa riylkowldaenPa fyapuditPam y£?yaaP wiyPSruwsnowbolz aend wewanlaendidonmayPa f£ys PaenPa aytukmayJartofsnwEninna Patent Pam botdaPa 218 THIRD GRADE ready. Well there was a campfire uh I well took my shirt off and uh oh um we um I rested by the campfire the snow melted. I drank some of the um uh water that it uh had left. And we had a nice time on my birthday. Two days of your birthday. No but uh theres one real date. And then uh for the party and uh thats when we uh went to my movie and things. And then the next day was my real birthday and I went with my cousins to the snow. That must be fun. It was. Well last Saturday my mother went to a trip to visit her father um because hes in the hospital and my aunt came down and took care of us. Well uh one time on um not Easter vacation I cant remember what uh vacation it was um my mom took us all out to see um a movie I think it was called Jerry Lewis in Only Money and um a Bob Hope thing. And uh. Bob Hope and Lucille Ball. Yeah. Critics Choice. I think so. Yeah I saw that. And uh when he tried to be a butler. Uh anyway um well he um when he uh after um uh he wanted to pretend to be a butler so uh he uh uh took his friends and said well uh he wanted to have a good family so he said he didnt really have a family so hes um asked his friends to pretend like he was a family his family and uh he got in all sorts of trouble because of a one lady that wanted to um he um Bob Hope to be uh her butler instead of another ladys so uh when Bob Hope was serving um one of the ladies um a drink she uh she um threw a dart in his bottom and he spilled all the drink he spilled the drink a cocktail on um uh his um well masters uh his ladys um lap. And he got into all sorts of trouble. And then when he finally decided to go back with the other um people he um he was he pretended to be a um he pretended to be uh lets see um I think something like a mayor or a famous uh wolf catcher you know um and horses they would go after you know wolves and rabbits and things. So anyway he didnt really know how to ride a horse at all. He uh got on the horse and hed fall right off. So um anyway he trip he um Lucille Ball tried well Lucy uh tried to help him uh that was one of the ladys a daughter she tried to help him to learn to ride a horse. So everytime he got on it he fell off. Uh that wasnt a real horse just a practice one. And then when the thing came he pretended like uh he couldnt run he couldnt ride a horsey um because he had a sore uh knee. And then they begged him. But he still wouldnt so one of these guys that hated him he wanted to marry Lucy but um he wouldnt uh but Lucy well when she he came Bob Hope came he uh Lucy didnt fall in love with him but you know started to like him a little better. And the other cowboy was jealous of her. INFORMAL SPEECH 219 kaempfayerEdiy w£l ftfrwazakaempfayar ?e ay wEltukmay/artaf ?an?e ow?8mwiy?em ay rEstadbaybakaempfwayar&an snowmdtid. ay draegksama&e?am. Pawotar&atad ?a haedlcft. aenwiyhaedanaystaymsnmaybarOdEy. tuwdcyzavyarbarOdcy. nowbat?a &£rzwannyldcyt. xn6en?a farbapartiy and?a 6aetswanwaaw£nt8maymuwviyan8iqz. aendEndanEksdEywazmayriylbarOdfy aen aywEqwiOmaykazins ta&asnow. ftaemasbiyfan. i?waz. walaesaetardEy mayma&arw£n?tuwatrip tavizidarfa&ar ?am kas hiyzinftahaspidal aemayaen?kEymdawnantukkEyravas. w£l?e wentaymon?am natiystarvakEy/in aykaen? riym£mbarwat?a k£y/in ?i?waz ?am maymomtukasPolawtte siy?em ?emuwviy?e Oiqkiwaskald lEriyluwisinowlniymaniy ?aen?em ababhowpOiq. aen?a. babhowpanluwsiyalbsl. y£?. kriteksCoys. ayOiqksow. y£ ayso&aet. aend?e wcnhiytraydebiyaba?lar. ?a iniywEy ?»m w£lhiy?am w£nhiy?e aeftar?am ?e hiywenddprat£ndabiyaba?l£rsow?a hiy?a ?a tukizfr£nzins£d w£l?a hiywandhaevagudfaemkysow hiys£d hiydidnriyliyav ofaemliy sowhiyts?am aeskthizfr£ndz tapartfnlaykhiywazafaemliy hizfaemliy aen ?a hiygat?inolsortsatrabel biyka?av awanlEydiyftat wanada?am hiy?am babhowptabiy?a harba?larinst£dtv anaftarlEydiyz sow?ew£n babhowpwasarviq?am wana&alEydiyzPam adnqk Jiy?a Jiy ?am 6raw?adart ?inhizbDdem aenhiyspildowl&adriqk hiyspild&adnqk ak3kt£ybn?am ?a hiz?am w£lmaestarz?a hizl£ydiyz?am laeap. aenhiygadinnaPDlsortsatrebol. aendEnwEniyfayaniydasaydad tagowbaekwi66iya&ar?ampiypelhiy? am hiywez haiypriytEndidtabiyaam hiypriytEnadabiy ?a psiy?am ayOiqksampmlaykamfyar or?efEymis ?a wulfktCer yenaPam nhorsazziywudgowaeftar yanow wulfsanraebitsanOiqz. saEniywfy hiydidnriyliynowhawderaydehorsetDl. hiy?a gatonnehorseniydfolraytof. sow?em £niw£yhiytrip hiy?am luwsiyeboltray? w£l?luwsiy ?atraydah£lpim ?a&ae?wazwana? ftalfydiyz ?edotar JiytraydtahElpimtalarntaraydahars. so£vriytaymhiygatonihiyfEl?of. ?a &ae?wezenariyelh38S Jastepraektiswan. an&EnwEnsGiqkEym hiypnytEndadlayk ?e hiykudnra? hiykudnraydahorsiy? ?em kaziyhaedasar?e niy. aen&EnnEybEygdim. bethiystilwudensow? wana&isgaysathEydhim hiywahedemaeriy luwsiybat?am htwun? ?e batluwsiy w£l wfnji? hiykEym babhowkEym hiy?a luwsiydidn?folinlev wi&iymbat yanowsartadtalaykhimalidalbEtar. aen ftiya&arkawboywazjElisavar. 220 THIRD GRADE So um well he made um Bob Hope uh ride uh the um wildest stallion uh there ever was and after that they had a fight in the bar and they threw um glasses of whiskeys I mean uh bottles of whiskey in each others head and they had a fight because um the bad um the cowboy knew what his who he really was and because he had he found a scrapbook that told who he really was and Bob Hope tried to get it away from him so he then he wouldnt be able to tell all the other people who he really was. And after uh that well he just wanted to run away because he didnt like it. Um and uh uh Lucille uh told him to come back and they promised that he would they would never um ever theyd never be uh mean to him again and thats how it ended. Thats a different movie than I saw. What one did you see. Uh let see its real funny. First um see Bob Hope was a I think he was a critic a writer I guess it is and Lucy wanted to write a play about her two sisters and her mother. And um and Lucy you know started writing this real long play about her sisters and and it took about a whole bunch of days and she wrote at night and the afternoon and um Bob Hope never um Bob Hope was Lucys husband and he never helped Lucy and then well I cant remember the rest. Well oh on Easter vacation we went uh all the way up to Big Sur. Uh first we got a cabin then we started to go hiking. And then we went back to the office and we we uh went on some hiking trails. And then when we came back um I mean and on the hiking trails we saw falls and we drank the water from there we went up to in in the very top of the mountain we looked down and then we climbed back down and then the last of all our hikes when we were coming uh back home I was running to catch up and I fell right on my side. And it hurt real badly. And the afterward and then in two days it started itching like mad.And now the scabs gone. Uh well when I um Im in cubs now and we our cub master takes us to a lot of um places like not mountains but uh camps. He took us to camp Hosefa. He took us to a football game. And to the police station. And I uh like the uh camp the best uh that where we stayed there was not mountains but a little a hill kind of with all kinds of bushes and trees in it and the cubs uh climbed it up. And after that we had lunch and. Oh we went on a five mile hike. And it turned out to be a a an eight mile hike baok and forth all together. And uh yesterday I mean the day after um that I was stiff I couldnt move my well I could move my legs but they really hurt from that eight mile hike and uh. Well we played in the mud and when I was up when I was up in the up in the um top of the hill um it was about not a mile high but about a block high I think. About two blocks up. And um. On Tuesday you know you always everyone runs to boy scouts and cub scouts. INFORMAL SPEECH 221 sow?sm wElhiymfydPam babhowp?erayds ftaPam wayldasstaelyinPa &£?Evarw8zansftar&aet&Eyhada fay?in6ebar aen6£y6r£w?em glaesszawiskiyz aymiyn?e badalzawiskiyiniyeaftarshEd aen&£yaedafayt kazPam ftabaePam bakawboynuw wathi? huwiyriyliywaz aen tykoziyhaed hiyfawndaskrspbuk &ctowldhuwiyriyliywaz mbabhowp trayddgidadawCyfremim sowhiy &£?hiywuenbiy£ybeletEtol6iye&erpiypel huwiyriyliywaz. PaenaeftarPe 6aet wflhiyjas wenndaranawCy kazhiydidnlaykit. ?am a n d ?a ?a luwsiyal ?a towldimtakambaekin st£ypramisimath£ywud ftfywudnEvarPam ?£var &£ydn£varbiy?a miyntehimegin aenftaetshawitEndid. aetsadifrantmuwviy&anays9. watwanadyuwsiy. aaltsiy itsriylfaniy. farst?am siybabhowp waza ayOiqkiwazakritik araytaraygEsitiz aenluwsiywanadtaraytaplfyabaw? her tuwsistarz aenarma&ar. PaenPam Paenluwsiy ynowstardadraytiq&is riyllsqplEyabawtasistarzan PaenPitukabawt PahowlbanfiedEyznJiy rowtetnayPniyaeftarnuwn ?an?am babhowpn£v£var?am babhowpwazluwsiyzhazbin aen?hiyn£varh£lpluwsiy xnftfn aaykaenPriymEmbarftarEst. w£l ?ow anPiystarvEykEy/anwiywEnPa al&awEyaptuw bigsar. ?a farstwiygadakaebin nEnwiystaratuwgowhaykiq. aen&£nwiy wEnPbaek teftiyofisinwiy wiya wEntonsomhaykiQtrfalz. aen&EnwEnwiyk£ymbaek Pam aymiyn ?aen?Dn6ahaykiQtr£lzwiysofDlz aenwiydraeqk 6awotarfrem6£r wiyw£napta?in in&av£riytapav6amaw?anwiyluktdawn aen&Enwiyklaymbaekdawn aen&En ftaixstavolarhaykswawiyarkamiQ Pabaekhowm aywazraniqtakaeeapaenayfElraytamaysayd. aenitharPriylbaedliy. Paen&EnPaeftarward aen&£nintuwd£yzistardadi£iqlaykmaed. aenawSeskaebzgon. w£l ?a wal wana ?am aymiqkabznaw anwiy arkabmaestartEyksestuwalatavPam pl£ysaz layk na?maw?anzbat?8 kaemps. hiytukastakaemphowsEfa. hiytukastuwafutbolgEym. snta&apaliystfyjan. aenayPa layk&aPa kaemp&abEstPa 6«? wErwiystEyd&Erwaz na?maw?onzbadelidal ahialkayndav wiSalkayndzav bujazantriyzinit aen&ekabzPa klaymdidap. aenaeftar&aePwiyhaedlanCin. owiywfntonafayvmaylhayk. aenitarndawtabiya aanfytmaylhayk baekanfarttoltagEftar. aend ?a yEstarda Pamiyn &ad£yaeftar?am &aet aywezstif aykudnmuwvma wElaykudmuwvmaylEgzbat dEyriyliyhart framnaetEytmaylhayk aenPa. weI wiyplEydm&amad in wanawazap w£naywazapin&a apin&aPam tapa&ahial Pam iwazabawt natamayelhaybet abawtablakhayayOiqk. bawtuwblaksap. PanPam. antuwzdEy yanowyuwolaz Evarywanrenztebayskawtsenkebskawts. 222 THIRD GRADE Well anyway um so I fell down rolling down a thing. I fell. I didnt do it on purpose. I was falling I fell down the thing you know rolling and you know theres these benches um uh where you not where you eat but logs kind of and I rolled down right between them then I my head landed right next to one. And I got bumped but uh it wasnt bad and but we had a real boss time. One time um um a friend of mine we um we were going to go on a bike ride. And we went all the way down to um it was um on Clarkson um on this side. No but on this side not on that side this side. And I see we went down this real steep hill and I was going so fast I was so scared you know and I forgot to put on the brakes and I ran right to the sidewalks. And um I had to have stitches up here and then I um had to walk straight on my left leg straight. And that hurt. Yeah for a week. I was a week absent. I went over to Stephen Hawsheys one time and and Paul uh lives right down the block from him so all together it was so hot we took off our shirts and only with our undershirts on and we went bike riding down uh alls kinds of hills through mud uh and water and things and all through um lots and oh all through hills and on sidewalks and up hills were the worst. Well uh so uh I um Paul and um all of us uh we were riding uh going down a real real steep hill that was going is a practically straight down. So anyway um we found this big we it was a big big mud puddle. And uh and uh there was a rock in front of it. So um uh I hit the um on my uh the bike that I was riding didnt hit go over the rock but it hit a part of it and I left flying into the mud puddle. And uh Paul um Paul uh stopped and so did Stephen Hawshey and uh Paul went to help me and he fell in and he and on accident uh uh he tripped uh Stephen Hawshey and he fell in and we got all muddy. I came here and played on the playground. Played handball. Play baseball. Well um we went on my sister wanted to go on the easter egg hunt. And um so we went on one in the backyard. And it was a uh yellow one that was in our lemon tree and my sister went under it and the wind blew it and it cracked on her head. And it fell out of the tree and it went on her head and it cracked. Nope. No. And then um when we were swinging on the glider and um these two little girls come over they live down the street and um my sisters friend. So they all get on the glider and theres about ten people all the neighbors were coming over and it was a real big glider it was loaded and it was swinging and all of a sudden one of somebody started screaming so we got off and then um someone and one of the litttle girls got her fìnger caught in the glider. We went on the Easter hunt at a park. And and oh we went um we went to um we went clam digging then but the first time we didnt catch anything but the second time we caught a lot of clams. Well you get a shovel and you dig under um these rocky places. At a certain time. Theres a the um tide is INFORMAL SPEECH 223 wElEniywEy ?em sowPayfEldawmrowliqdawn Pediqg. ayfEl. aydinduwitonperpes. aywazfoliQ PayfEldawn&aGiqyanow rowliq aen yanow &£rziyzb£njaz?3n ?ew£ryu? nat w£ryuwiy?bet logzkayndev aenayrowldawnraytbiytwiynam &Enay mayhEdlaendedrayPnEkstuwan. aenaygaPbamptbatPa iwaznPbaed in batwiyhaedariylbastaym. wantaym ?am PamefrEndamayn wiyPam wiywarganagowonabaykrayd. aen wiywEnPal&ewEydawntuwPam iwaz ?am onklarksen ?em Panftissayd. nowbaPan&issayd natonbaetsayd ftissayd aend ay siy wiywEntdawn&isnylstiyphil aen PawazgoiqsowfaestaywasowskErdyanow ?aen Payfargataputon&abrEyks aeayraenraytta&asaydwsks. aenPam ayhaedtahaevsti£azaphier aen&En?ay?am haedtawokstrEyt PamaylEftlEgstrEyt. n&aethart. y£ farawiyk. aywazawiyk ?aebsint. aywentowvartastiyvanhojiyzwentayman ?aenpol?e livzraytdawn&ablakfarhimsow oltagE&ar iPwasowhaPwiytukofaer/arts aendPownliywi&arandarJertssn aenwiywEnPbaykraydtQ dawnPaPolskayndzavhilz 6ruwmad?a aenwataranOiqz aenalOruw ?am btsin owolSruwhilzan Ponsaydwoks in aphilzwarbewarst. w£l Pasow ?a?ay?am polind?em ?olavas Pawiywaraydiq ?a goiqdawnariylriylstiyphil ftazgoiQ izapraektikliystrEytdawn. sow PEniywEy ?am wiyfawn&isbig wiy ?i?wazabigbigmedpedel. aend ?a ?aen?e bErazarakinfranivit. sowPam Pa ayhit&aPam onmay a&abayk&ataywazraydii) didnhi?gowowver6erak badihitapartavit aen aylEftflayiqinna&amadpadal. aendPa palPam polPa stapt insebdidstiyvanha/iy aenPapalwentahElpmiy aenhiyfElininhiy aenPonaeksidmt Pa Pahiytript PastiyvinhoJiyinhiyfElianwiygadolmadiy. akEymhiyranplEydonneplEygrawnd. plEydhaendbol. plEybEysbol. WE I Pam wiy wEnon maysistarwanndagowonftePiysterEyghent. aen {am sowiywEntsnwaninnabaekyard. Paend iwaza Pa yElawan ftaPwazinarlimantriy PaemaysistarwEnendarit an&awinbluwit aenitkraektonerhtd. anitfElawtavbatriy anitwEnonartd anitkraekt. now?, now. aen&En Pam wEnwiarswiqiqon&aglaydar Paend Pam lyztuwlidalgarlzkamowvar &£ylivdawn&astnyt Paen Pam mesistarezfrEnd. sow&Ey PolgEdon&aglaydar an&Erzebaw? tEnpiypal ol&entyberzwerkeminowver aniazanylbigglaydar iPwaz Ihowded aeniPwazswiqiq Panoalsadin wane sambadiystaradskriymiqsowiygadof PanP&En Pam samwan PEnwana&alidalgaralzgadarfiqarkaPanaglaydar. wiywEnan&aPiystar onaedapark. aenn aen PowiywEnPam wiywEntaPam wiyw£ntklaemdigiQ&En baP dafarstaym wiydin?kaet£Eniy6iqbat ftesEkintaymwiykodaladav klaemz. wElyuwgEda/avalin yadigandar Pam biyzrakiyplEysaz. aedasarPan toyn. ftErza AaPam 224 THIRD GRADE low and you could go clam digging. Yeah. Once we went to the beach and um my brother me and my sister were making a castle and um me and my sister brang these two small shovels and uh me and my brother could make the castle without them so we gave them to our junior high brother and he its flat and then a big thing like that and he digs a big hole through it and then he says come on in my second brother comes in and it caves in. And um he wanted to make the castle real deep so he went down about three feet and then he start going down more ahd he there was a big crab came out and he picks up the crab and says hey mom whats this. How much is one and one. Two. Um what kind of a dog doesnt bark. A wienie dog. A hot dog. Aw. Tell me what what what person doesnt talk. You. What kind of a duck doesnt say quack. You. Dead duck. Make that noise again you go. What should we talk about. Well once we saw this um comedy on television. It was real funny. It was and they went in this um haunted house and they found this little thing so they tear it open and theres a box inside there. Um so they didnt know what to do with it so he theres three guys so one of them sits down in in a chair and then he um starts looking at you know looking at it and then no one else is looking theyre just going all over the um house and then theres a trap door and it turns around the chair on the other side just like it and then um the other guy says hmm he was sitting right there now where did he go so they sit so one another guy sits on it the same thing happens. And then the other guy says hmm they both sat there. So he says Im not going to try it. And he looks away and then um he looks back at it theres a skeleton sitting on the chair. I saw a movie about a man he sits on a um uh a bomb that was going to blow um in three seconds so he sits on it and he blows up with it and hes all the way up in the sky. On the cartoon at the end um it was about it was a little guy his name was Slippery Bly International Spy so hes holding a firecracker and he says oh now a fire. And then it blows up and he says cracker. It does crack. Cracks in half. Make those noises you always do in school. Knock knock. Whos there. Ash. INFORMAL SPEECH 225 taydizlow anyakad gow klsmdigiq. y£h. wantswiywcntuw&abiyfiaen ?em maybre&er miyanmaysistarwar mfykiqakaesal ?aen Psmmiyemaysisterbrcq&iyztuwsmal/evelz ?aen?a miyamaybraftar kudm£yk6akxsalwi6awdam sowiygtyvem tuwarjuwnyarhaybra&er anhiy itsflae??anenabig 8iQlayk&ae?aniydigzabighowt sflruwi? ?an&cn hiysczkamsnin mahysckandbra&arkamzin aenatkcyvzin. ?aen ?am hiyweandamcyk&akasalriyldiypsow hiyw£n?dawnebaw?8nyfiy?en6£nhiystartgoiodawnmDreniy ftErwazabigkraeb kcymaw? aemypiksap&akr£bins£z heymam wats&is. hawmafiizwantndawan. tuw. ?am watkayndavadsg dazitbark. ewiyniydog. ?ahatdag. ?aw. tcwmiywat wat watparsandazantsk. yuw. watkaynavadakdazantsfykwsk. yuw. dcdek. mcykdaetnoyzagcnyagow. wafiawiytakabawt. wflwantswiyso&is ?am kamadiy ?em tElaviZin. iwazriylfaniy. iwez ?«n6£yw£nin&is ?em honidhawsan &Eyfawnd&islidal8iQsowb£y Uridowpen annErzabaksinsayd&Er. ?em sowiydihna?nowataduwi8itsowhiy ftfrsriygaysow wanavamsitsdawnin ?inaC£ren&£n hiy ?am startslukiQst yanow lukiqaedit an&fn nowanflsazlukiq 6£rJisgowiqol?owvarAa ?em hawsan&En AErzatraepdaranittarnzarawnd ftaiEron&iyeftersaydJazlaykit ?xn&£n ?em &a6argays£zhm hiywasidiqrayt&Er nawwfradiygow sowftiysed sowwan ?ana6argaysits3net&as£ym8tq£penz. sn£niye&argays£z hm 6£ybow8sst&£r. sowiysEzaymnaPganatrayit. aruyluksawEyan&an ?am hiyluksbaekae?at AErzaskElitin sidirpnnaCfr. ?ay soe muwviyabawdamaen hiysitsona ?em ?a abam &ae?wazganablowapin8nys£kins sowiysitsanit eniyblowzepwiSit ?niyzolew£yepineskay. ?3n&akartuwnae?&iy£nd ?am iPwazabaw? ?iwezelidalgay hiznEymwassliperiyblayinternaeJenalspaysow hiyzhowldiqafayarkraekarmysEz ?ow nowafayar. ?en&£ru?blowzepeniys£z kraekar. i?dazkraek. kraeksinhaef. mEyk&owznayzaz yuwolwiyzduwinskuwal. nak nak. huwzfr. 226 THIRD GRADE Ash who. Knock knock. Whos there. Water. Water who. Watermelon. Whats the best thing to put in pies. Your teeth. Whats the worst thing to put in urn whats the worst thing to put in a banana. Your nose. Might sneeze. When my sister says the three bears but when she gets to the part where they go up the stairs so she says that all right then when she says when the papa bear goes and he says when his when Goldilocks sits in the momma bears bed she says and it was so soft that when she got in it it the sides the sides went way up to the window and she couldnt see out. Tell me that one um tell me that knock knock one. Oh kay. Knock knock. Whos there. Boo. Boo who. What are we supposed to talk about. Tell him to stop burping. One night my sister was going to sit on my dads lap so my dad says wait a second and he takes off his shoes you know. And then Suzie sits on his lap. And then well she says pee yu what stinks so bad. And he and dad says why its your feet of course. Another night she was she bumped her head and she said mom I bumped my head. And then Momma didnt answer because she was in the ironing room and she couldnt hear so she says mom I bumped my head real loud and then dad says well do it again. Yeah I have three brothers. I have two brothers and a sister. I have two brothers two at home and myself is four. I have two sisters and um let me see four kittens and one mother kitten and and we sold one of the uh baby guinea pigs and theres um and theres one baby and uh one mother and we have um. No we have my sister um my baby sister has ten birds. And um two babies. At first we had the baby kittens then the baby uh guinea pigs then the no then the um baby birds then the baby pigs. About a year ago my brother two of us um went over to um his friends house and then he went way down the street you know. And he saw this cat so he found out who it belonged to and they said he could have it so so momma said he could have it and um about about three weeks afterwards it started having babies and then my dad doesnt like that and it had six then it had five then it had four then it had six again and that all adds up to twenty INFORMAL SPEECH 227 Paejhuw. naknak. huwzEr. wader. waderhuw. wadarmElin. watsdabEsOiQdapuPinpayz. yertiyO. wets&ewarsdiQQ tapudin ?em wats&a warstdiqdapudin ?abanxne. yarnowz. maytsniyz. wcnmaysistar s£z&a8riyb£rz bawEntiygEtsa&aparfwEr&Eygowap&a stersowjiy stzzaetoray? &£nw£jiysaz wEndapapabEr gowz nhiyscz wanhiz wenngowldiylaksitsin nemamabcrzbcd jiysEz ?aeni?wesowsafdae?wtnfiygadinit i? ftesayz ftasayz w£n?w£yap tuw&awindow ?anjiykudan?siyawt. t£lmiy&ae?wan ?am t£lmiy&ae?naknakwan. owkfy. naknak. huwzftEr. buw. buwhuw. watarwiyspowstetokebawt. tdimtastapbarpiq. wannayt maysistar wezgonesidomaydaedz laepsowmay daedsEzwEytesEkin niytcyksofis/uwz yanow. ?aen&£n suwziysitsomzlaep. aen&an wc/i? sEzpiyyuw watstiqkssowbaed. eni andaedsEz way ?itsyarfiyt afkors. ene&ernayt Jiywas Jiybamptarhed aenJiysEd mam aybamptmayhEd. a&Emamaditantaensar kafiywazinniyayaniqruwm eniiykuttnthiyr sow/sEz mamaybemp?mayh£d nylawd ann£ndaeds£z wElduwidagEn. yEayhavOriybra&arz. ?ayavtuwbre&erzinasister. ayavtuwbra&arz tuwaethowm aenmayselfizfor. ayhavtuwsistarz ?aen ?am lEmiysiy forki?enztn wenmeftarkitannEn En wtyssowlwanav&a ?a bfybiyginiypigzEn&Erz ?am aen&ErzwanbEybiy ?aen ?a wenme&er ?an wiyhaev ?am. now wiy haev maysistar ?ammaybEybiysistarhaeztEnbardz. ?£nd ?em tuwbEybiyz. atfarstwiyaed&ebEybiyki?enz &En&ab£ybiy ?a giniypigzzEnna now &En&e?em bEybiybardz bEn&abEybiypigz. bawdayiyragowmaybra&ar tuwavas ?am wEnowvartuw ?am htzfrEndzhawsan&EniywEn? wEydawn&astriy? yanow. aendhiyso&iskaets showhiy fawndawthuwi?babqtuw annEysEdhiykudhaevitsow sowmamasEdiykudhaevi? ?aen ?em ?ebaw? ?abaw?eriywiyksaeftarwerdz itstardaeviqbEybiyz ?aen&Emaydaedazanlayk&aet aend itaedsiks bEiaedfayv fttiaedfor &Eiaedsiksag£n anbae? 228 THIRD GRADE one babies. And my dad got real mad. Because it was a real big grey one you see about that tall you know and then see he waits until its night time and everyones asleep. And then um theres a little hole in the um garage door you know and thats where we keep him in the garage so he comes through the hole and he goes in my dads bed. He crawls down the covers and he licks his toes. At nighttime. You mean your fathers sleeping in the garage. Oh um theyre all finches and my and my sister I think her hobby is um uh. Birds. Yeah birds. The bird. The bird. Yeah. The father died. No they stay outside. And we have fishes. What. Um once in the classroom they were they had a um record player and then um we were going to listen to a record and when it came the groups turn that I was in well it had something about a horse and then two boys got it from this um pet store and then the um the horse had to uh wear a hat on his head. When he turns the corner you have to get up get off and take his hat and throw it over there and hell go get it. And his name was. Low Joe. No. Here come. It was Here Comes something. Yeah Here Comes something. Remember they said a horse with a real head. Yeah. See their daddys see they told their daddy that they had fifteen dollars and they were saving up to get a horse because they wanted to um to have a horse because they didnt want to walk. And then the daddy took takes them down and he says okay theres. Okay 111 get you a horse. And then the boys say what. A horse with a real head. When I grow up I want to be an architect. I want to be an archaeologist. What do you want to be. I dont know. Well. I know what you want to be. What. A girl. I dont know really. I want to be a artist or a teacher. Good. You start it. Yeah Donald. Which school did you used to go to. Well lets see. Did you go to any military schools. No. INFORMAL SPEECH 229 ?3laedzaptatwaniywanbEybiyz. amaydaed ga?rilmsd. kazErwazariylbigrEywanyasty ebaw?&ae?tol yanow Pan&En siyhiywfyts antilitsnaytaym anEvriywanzasliyp. an&cn ?em ftErza lidal howlin&a ?am gara}doryanow an&sswErwiykiypm in&agaralsow hiykamzOruw&ahowlan hiygowzinmaydaedzbcd. hiykrolzdawnnakavarz aeniyliksiztowz. ae?naytaym. yuwrniynyarfaftarsliypaninftagara]. ow am ftcrslfiniazaeod may EnmaysistarayOiqk harhabiyiz ?em ?e. bardz. y£ bardz. dabard. dabard. yeah, ftafa&ardayd. now 6cy stcyawtsayd. Enwiyaevfijaz. we?. ?em wants?in&aklaesruwm6Eywar &cy hxdePem rckardplEyarn&an ?am wiywar ganalisantuwarckartan wcnitkeym&agruwp starn&adaywazin w€li? PhaePsampmabawdaharsan&En tuwboyz gaditfram&is?am pEtstar ?an&£n &e ?am bahorshaeda ?a wErahaedonizhEd. wEniytarnzdakarnaryaefta gidap gidofentiykiz haetnGrowidowvar&EranhiylgowgEdi?. aeniznEymwaz. lowjow. now. hiyrkam. iwazhiyrkamssamOiq. y£a hiyrkamsamtiq. m£mbar6£ys£d PahsrswibariylhEd. y£. siybErdaediys siy&Eytowld&Erdaediy &ae?b£yadfiftiyndalarz anEywarsEyviqap tagEdahars bikazzEywanad te?am tahEva hors bakazEydidan?wanawak. aenbEn badaediy tuk tEyksamdawnaniysEz owkEy&Erz. owkty algEtyuwahors. aen&En&abaysEy wat. PahsrswibariylhEd. wanaygrowap awanabiyanarkatEkt. aywenebiyenarkiyalajist. wadayuwannabiy. aydown?now. wEl. aynowatyawenebiy. wat. ?agaral. aydown?now riliy. aywanabiya?artisaratiy£ar. gud. yuwstarti?. y£ danald. wiCskuwIdidyuwyuwstagowtuw. w£I latsiy. dijuwgowtuwtniymilettriyskuwlz. now. 230 THIRD GRADE Did you. Girls cant go. Well um. I went to two of them. What. Um Brentwood and um Ramsey. Those arent military. Brentwood isnt. What other schools did you go to. Um I went to Millies Nursery School. I went to Richland Avenues Nursery School. And I went to um my teacher in kindergarten was Miss Lacey. Then in um ae three I had Miss Stockier and then Miss Carver then Miss Kelley now I have Miss Bough. And in um lets see I had Missus um in kindergarten I had Missus um um. Who was it um. I dont know. Greenly. I had Missus Greenly and I went to another um you know one of these schools and then its name was Childrens Paradise. Well uh first first I went to Millies Nursery School then I went to Miss Laceys class here then I went to then I came to Missus Browns class then Miss Stockers then Miss Peterson then I went to yu cee ell ae and now Im here in this of ours. I went to yu cee ell ae or some people call it yu ee ess. Well this Saturday Im going to go to um Disneyland. And on um May eleventh Im going to the circus and Im going to have a practice game and uh last Saturday we had a practice game and we lost twenty to four. Um and yesterday we had a practice and today we were working in school and um when Im about twelve Im going to take up science a little bit. And um lets see left to say. Well what was I going to say. I dont know. Youre doing it Donald. Lets see. I hate to be vulgar. Well you know Ricky well this uh Wednesday Im going to get some uh Scoutarama tickets and Serlos going to get some and um Richard Serlo hes going to get some at uh Tuesday. Tomorrow. And then um we were going to sell them for a dollar and then the more we sell we like if we sell two we get this little tiny uh camera. And then if we its a dollar for one um its a dollar theres ten tickets theres ten tickets to a book. And one and one ticket one ticket one ticket calls it would cost a dollar and theres ten of them in the book so it costs ten dollars. Um do you want to buy a ticket to Scoutarama. INFORMAL SPEECH 231 didyuw. garlzkaengow. w£l ?am. aywEntatuwav&am. wat. ?am br£n?wudaenam rxmziy. 6owsan?militcriy. brtntwudizent. wada&arskuwlzanyuwgowtuw. am aywtntamiliyz narsriyskuwal. awintuwritlannaevanyuwz narsriyskuwl. anaywEntuw ?am maytiyCariQkinargardanwazmislEysiy. &£nin?am ?£y6riyayhaedmisstaklar aentnmiskarvar &cnmisk£liynawayxvmisbaw. ?aen?in?am letsiy ayaedmisazam ?iQktruygardenayaedrrusezam ?am. huwwazidam. aydownow. griynliy. ayadmisaz griynliy aenayw£ntuwana&ar?am yuwnowana&iyskuwlz ?aen&£n ?tsn£ymis6ildrenspaeradays. w£l ?a?ferst faystaywEntamiliyznarsanyskal n£nayw£ntuwmisl£ysiysklaeshiya 6tnayw£nta &£nayk£ymtamisazbrawnsklaes s£nmisstakaz dEnrruspiytarsen &£nayw£ntayuwsiy£l£y ?aennaw?aymhiyr inftisvaews. aywEntayuwsiyElEy arsempiypalkDli?yuwiy£s. w£lp 6isaederd£yamgonegowte am dizmylaen. aendon ?am£yal£van8aymgowiqtuw&asarkis aenaymgeneaeve praektisg£ym ?aend ?a laes saedardeywiyaedapraektisgtymaenwiylostwaniytefor. ?am ?aend yEstadfywiyaedapraektis ?aentedEywiywerwerkininskuwel aendem wEnamabawtwElvaymgonEtEykapsayEntsalidalbit. aenam lEtsiy l£ftas£y. w£l wawazayganasEy. aydownow. yarduwirjitdanald. letsiy. ayhfytabiyvalgar. we I yanowrikiy wElfiis ?aw£nzd£y a m g a n a g i t s a m a skawdaraematikits aendsirlowz g a n a g i t s a m ?aenam riCardsirlow hiyzganagitsamaet?a tuwzdfy. tamarow. aen&£n?am wiyarganasElEmfaradalar artEnnamorwiysElwi? laykafwiysEltuwwiygitdis lidaltayniya kaemra. aenEnifwiy itsadalarfarwan ?am itsadalar ftErstfn tikits &£rst£ntikitstuwebuk. aendwan aendwantikit wantikis wantikitkolz idadkostadalar aen&£rst£nav6am in&abuksowikost Undalarz. ?am dayuwennbayetikettskawderaeme. 232 THIRD GRADE Do you. Huh. Aw baloney. It just cost a buck. Theres going to be professional football players professional basketball players um and a swim meet and were going to put up a booth and so are most of the packs and troops and everything. And were going to have all this equipment for for tomorrow. Programs. And um in cub scouts Im uh in first place of all of them except for one. Me and Keith are tied in um running. And um me and Keith are tied in um in jumping. And then um and. But Im Im ahead in running and jumping. I did. Five foot five. No I didnt. Five foot six and a half. Five six and a half. And then um lets see. Are you married. No. Well then you can only buy one ticket so buy one from me. Buy one from me. See my dads my moms the second highest in the cub pack my dad used to be the highest oh come on. Please. Well do you get money for doing this. Where do you live. Is there any cub scouts around there. How many. What what pack are they in. They better not be in thirty seven. They better not be in uh one uh thirty seven either. One forty two. One forty two. Um. Thats my brothers one. No its. Its two thirty seven. Yeah. Um. Lets see. What do I say. Do you have any brothers or sisters. Well I intend to die when Im about two thousand ninety nine hundred and seven million. I intend to die really when I see someones face. I intend you to die when when um when youre nine. Well I was sick Saturday. Got around twenty inches of hair. I was sick sick Saturday and I threw up and I had a temperature of a hundred and two. And now my mothers sick and my mother and daddy are going to um New York and Nassau on Wednesday. Nassau and New York. And my baby sisters nine months old. And if um we well two hundred books which I wish we could we get to go to trip to Chicago or Europe or where is it. INFORMAL SPEECH 233 duwye. he. aaa balowmy. itjistkastabak. 6arzgenebiyeperf£Jenelfutbalpl£yerz praf£jenalbaeska?balpl£yerz ?em ?aenaswimmiyt aen wirganapudap ?abuw6 aensowarmowstav&apaeksaentruwps anevraOiq. aenwarganahaevol&is kwipmin?fer fartamarow. prowgraemz. aendam ?inkabskawtsaym ?a ?infarstplcys 8v?3lavamckscpfarwan. miyankiyOartaydin ?em raniq. aen ?am miyankiyOartaydinam inlampiq. aenftcn ?am ?aend. badam ?amehcdinreniQ injampiq. aydid. fayfutfayv. nowaydiden?. fayfutsiksinahaef. fayvsiksinahaef. aen&cnsm lEtsiy. ?aryuwmaenyd. now. wEl&Enyuwkinownliybaywantiktsowbaywanframiy. bayfwanframiy. siymaydaedz maymamz basEkinthayastinnakabpaek maydaedyuwstabiy&ahayast ?owkaman. pliyz. wElduwyagiPmeniyfarduwinrus. werdayaliv. izarcniykabskawtsarawnncr. hawmcniy. hwat hwatpaekar&cyin. 6cybcdarna?biyineardiyscvin. &£yb£derna?biyin ?awan ?e Osrdiyscviniyftar. wenfordiytuw. wanferdiytuw. ?am. ftaesmaybra&arzwan. nowis. ?itstuw9ardiys£vin. y£a. ?em. l£tsiy. weduways£y. dayaeveniybra&arzarsistarz. wElayintfndadaywanaymabawt tuwOawzannayndiynaynhandnd PentsCvinmilyin. ayintcndadayriyliy wEnaysiysamwanzfEys. ayantcnyuwdadaywcn ?amw£nyernayn. wElaywasiksaedardfy. gadarawntwaniyin£ezah£r. aywastk sik saedardtyanayOruwap aenayaedaUmpafiaravahandardantuw. aenawmayma&ersikaemayms&arandaediyargoyQgE ?emnuwyork?aennaesaanw£nzd£y. naesaanuwysrk. aemaybfybiysistarznaynmanOsowld. ?aen?iffam wiysEltuwhanradbuks wifiaywijwiykud wiyg£tagowtuw triptuw/ikagowayurap ?erw£rizit. 234 THIRD GRADE Mexico. Mexico. Two tickets to Mexico. We might doubt that. Just try. We can go there any day. So can we. Because my daddy works at American Airlines. Hes a meteorologist. Um my dad works my dads well my um dad work makes blouses and he sells them to Campus Casuals of California. And um sometimes he makes skirts and junk. Does he wear any. Shut up. Um sometimes um he makes dresses at least we least my mom gets them free. And um she wear any. And you know he has like a and he has like a pencil company that he owns. He has like a pencil company that he owns and he um and they make a mess of pencils. It says Cila Garment Company. Sixty four Market Street Venice California. And then um lets see. Well theres a real stupid girl in our class and her names Joanne. Susan Unger. And Joanne and she wears a real sloppy petticoat. Yeah. When she walks when she bends down like this. Her dress comes up. Her whole dress comes off. It almost slides off. And you could see her um underwear. And she makes. I want to ask you something. Its my turn. My turn. I want to ask you something. And and she brings Peter Pan records to school and we have to listen to them and. And we have to eat them. And and she goes to this nut the nuttiest boy in the class his name is Michael Rubin he doesnt know what one and one is. And she goes to his birthday party. And he kisses and he kisses them and stuff. Yeah and Michael Rubin always go oh Susan I love you. I love you. And he kisses me and junk. Now its my turn. Well uh lets see. Well lets see. I want to tell you something. Lets see um. What. Well there were twenty sick there were twenty sick sheep one died and how many were left. INFORMAL SPEECH 235 mCksikow. mEksika. tuwtikitstuwmEksikow. wiymaytdawtftet. Jistray. wiykingowftercniydcy. sowkinwiy. kazmaydaediywerksaetamErakanErlaynz. hiyzamiytaralajis. ?am maydaed warks maydaedzwElmay?amdaedwark mEyksblawsazaeniysElzEmtakaempiskaguwalzavkaelifornya. aend?am samtaymzhiymcykskartsanjaqk. daziywErEniy. Jadap. ?am samtaymz ?em hiymeykstresaz aetliystwiy liystmaymamgttsemfriy. Paend ?em Jiywcrcniy. Paend yanow hiyaezlayka aeniyhaezlaykapEnsilkamparuy&aediyownz. hiyaezlaykapEnsilkampaniy&aediyownz PaenPiyPam aen&EymEykamEsapEnsilz. itsEzsilagarmanPkampaniy. sikstiyformarkatstriyt vEniskaelafornye. aen&Enam lEtsiy. w£I &ErzanyistuwpagarelnarklaesaenernEymzJowaen. suwzinaogar. ae? lowaenaenJiywErzariylslapiypEdiykowt. y£. wEnjiywaks wEnJiybEndzdawnlayk&is. hardrEskemzep. harhowldrEskamzaf. itowmowsslaydzof. anyuwkadsiyaramPandarwEr. aen/iymtyks. aywanaaestyuwsamGin. itsmaytarn. maytarn. aywanaaeskyusamOin. ae? PaenJiybriogzpiydarpaenrEkardz taskuwal aenwiyhaeftalisantuwam ?aen. aendwiyaeftaPiydam. ?aend Paentjiygowsta&isna? &anadiyastb3yinaklaesiznEymizmaykalruwb8nhiyd8zan?nowa?w8ninwaniz. PaendJiygowztaizbarOdEypardiy. aeniykisaz Paeniykisaz&amanstaf. y£ aendmaykalruwbinawiyzgow Powsuwzin aylavya. aylavya. aeniykisazmiyaenlaqk. nawitsmaytern. we I ?e lEtsiy. wal latsiy. aywanatElyasamBan. lEtsiy ?em. wet. wEl&Erwartwaniysik &ErwartwaniysikJiyp wandayd anhawmEniywerlEft. 236 THIRD GRADE Huh. I want her I want her to Miss Stone to answer it um. There were twenty sick sheep one died and how many were left. Twenty five. No. Twenty two. You guess. It its twenty two. How come. Because. Twenty sick. I didnt say six so theres only twenty I said twenty sick. Theyre sick. Twenty sick sheep. Once there was these three men in Alcatraz. And the um guard came around and he said the one who the one who um gets tell each part of the body can go out free. And so um the first one said he said wheres your elbow he said where right here. He says wheres your head. He said right here. He says wheres your foot he says right here. And so he you cant go. So he goes to the second guy and he says wheres your knee he says here. Wheres your hand he says here. Wheres your head he says here. So he cant go so the next guy says wheres your elbow he says here wheres your head here. Wheres your um foot. Right here. And so he says so he can go. And so then the other guy said how how did you do it. And the other guy says brains. If you drop a hat in the wet sea in the Red Sea what would it become. Wet. Wet. Do you know a girl from yu cee ell ae her name is Carol Salonka. Do you know um a girl and her name is Irene Dass. Irene Bass. Irene Basseses. Well theyre my Sunday school teachers. Teachers. Do you know a a woman named ah Miss Small. You know she had in my Sunday school she always goes like she always goes like this. Thats her. You are her. What Sunday school do you go to. He goes to church. Yeah I go to church. I got to go to church I got~to stay in church for about three hours. We stay in Sunday school for two. And then I got to eat. We cant even play we have to eat for around. Either can we. We cant go out we have to eat stay in the building and we have to eat for for around two hours. Youre lucky. INFORMAL SPEECH 237 he. awen?her awen?herde?aen misstownneaentserit ?em. ftcrwertwaniysikjiyp wendayd nhawmcmywerlcft. tweniyfayv. now. twentytuw. yuwges it itstwaniytuw. hawkem. kaz. twcniysik. adiden?s£ysiks sowftcrzownliytwaniyaysEdtwaniysik. ftcyrsik. tweniysik/iyp. wentsErwaziyzOriymEninaelketraez. aend AiyemgardkEymerawneniysEd ftewenhuw ftawenhuw ?em gits tcliyCpardevbebadiykingowawtfriy. endsow ?em ftafarstwensEd hiysEd w£rzyar?£lbowiys£d wcr raythiyr. hsezwcrzyarhcd. lyscdraythiyr. hiysfz wcrzyarfut hiystzraythiyr. aendsowht? yuwkxntgow. sowiygowztuw&es£kendgayeniys£zw£rzyerniyiys£zhiyr. werzyarhaendiyscz hiyr. wcrzyarhcd hiysEzhiyr. sowhiyk«n?gow sow&ancksgayscz wcrzyedbowiysczhiyr wcrzyerhcdhiyr. werzyer?emfut. raythiyr. «ndsowhiysez sowhiykeqgow. «ndsow&cnftiyeftargayscd haw hawdidysduwit. aendftiyeftergayscz brcynz. ifyuwdrapehaet?n&ew£tsiy ?in&ar£dsiywe?wuditbiykem. wet. wet. deyuwnow?e gerl franyuwsiyElEyerncymizkaralselaqke. dayuwnow ?em ?agarlnarncymiz ?ayriyndaes. ?ayriynbaes. ayriynbxsasez. wcl&eyrmaysandiyskuwltiyfiars. tiyfiarz. dyuwnowe ?awumin£ymdahmismal. yuwnow/iyae?in maysendiyskul siyawiyzgowzlayk Jiyowiyzgowzlaykis. ftaetsher. yuwrhar. wahsendcyskuwldeyuwgowduw. piygowsta£er£. ych haygowda£ar£. aygadegowda£ar£ aygadest£yin£ar£farehawt Oriyawerz. wiystEyinsendEyskuwIfertuw. en&Enaygada?iyt. wiykaruyvenpl£ywiyafte?iytfererawnd. ly&erkaenwiy. wiykaen?gowawt wiyaefte?iy sttyin&ebildiQ enwiyaeftsiytfer ferarawndtuwawarz. yarlekiy. 238 THIRD GRADE We cant go out and play. Youre lucky. You get to eat. Well our teachers real nice because she lets us um she get she go we have like a you know the Craigs on um Gateway Boulevard. Yeah. Here. Down here. Well um we have something like the uh um we only have Sunday School about two um houses away or not houses but big as houses. I got a good one. And um so she always gets everything there she gets cookies and you see we have this real stupid substitute his name is Mister Londen. Mister London. You should call him Mister Paris. You should call him Mister London Bridge is Falling Down. And and so he chews gum so one one day he chewed it and um he spit it um on the floor. And so this girl steps on it. And so she cant get up. And so her name is Vickie the girl who stepped on it. She would. No not that Vickie. And then so she was trying to pull it and so she couldnt. So she um tried and then she fell down and then. And all the air pumped out. Huh. Then she fell down and then she was stuck to the floor. And then um I tried to help her up but she couldnt get up because Mister London spit the gum down so um Mister London had to go to away and and she had to stay and finally someone got her up and she and her and it was her best um diamond dress it cost two hundred dollars and her mother had. Youre full of it. Youre sure full of. Brains. Brains. New one. Diamond. Not diamond but fake diamond. Well it wouldnt cost two hundred. This morning well when I went to the doughnut shop I went to get a doughnut and I put some Curad on um some Curad bandaids in my uh hand and then I had put a dollar in my other hand. Then I thought the dollar was in this hand. And it was the Curad bandaid really in this hand. So you paid him. And I pay him and I throw the bandaids on the counter. And she says these are bandaids. Oh you mean Primos doughnuts. Yeah. You know this morning I I got you know I was supposed to get up at seven thirty and I got up and then I start fooling around and then I INFORMAL SPEECH 239 wiyksn?gowaw?anpl£y. yarlakiy. yuwg£ta?iyt. wElartiy£arzriylnaysbiyk3jiyl£tsas ?am Jiyg£t Jiygow wiyhaevlayk?e yuwnow6akr£ygz3n?am g£ytw£ybulvard. y£ hiyr. dawnhiyr. w£l?am wiyhaevsamp?mlayk&iy?af ?am wiyowniyhaevsandEyskuwabawt tuw?am h a w s a z a w f y a r nathawzazba? bigazhawzaz. aygadagudwan. aen?am sowJiy3wiyzg£s?£vriy6iq&£r jiygEskukiyz ?aen yasiywiyhaev&isriylstuwpadsabstistuwt iznEymizmistarlandin. mistarlandin. yuw/udkolimmisterpaeris. yuwJudkolimmisterlandinbriJizfoliQdawn. ?aend aendsowiy£uwzgamsow wan wand£yhiy£uwdit ?aen?am hiyspidit?am ?anftafby. Psndsow&isgarlstEpssnit. ?£ndsow/iykaen?g£tap. aendsow harnEymizvikiy &egirlhuwst£ptanit. Jiywad. now nat&aevikiy. aen&£n sow/iyweztrayiQtafulit ?aendsowJiykun?. sow? Jiy?am traydan&EnJiyfcldawnaen&cn. aendal&iycrpamptawt. he. d£njiyf£ldawn aennEnJiywasstakta&aftor. ?aen&£n ?am aytraydah£lpar ?8pbatjiykud8n?g£dap bakazmistarlandan spit&agamdawnsow?am mistarlandanhaedagowduw ?aw£y ?aend ?aen/iysdast£? aen f a y n a l i y s a m w a n g a d a r a p aendjiyaenhar aenitwazharb£st?am daymindrEs Pikastuwhandradalarzaenarma&arhx?. yarfulavit. yar/arfulav. brfynz. br£ynz. nEwwan. daymind. natdaymindbatffykdaymind. wEliPwudankastuwhandard. ftismorniq wElwEnaywEnta&adownatCap aywEntagEdedownet anayputsamkyuradon a m s a m kyuradbsndEydzmmay Pehaend aen6 EnayhaedpudadalarimayPa&arhaend. &Enay6at&a da?larwazin&isssn. aeni?w8z6ekyurepaend£ydriyliyin6ishaend. sowyuwpEydhim. sndaypEyim aenayGrow&abxndEydzon&ekawndar. aenCiysEz &iyzarbsnd£ydz. ow yuwmiynpriymowzdownats. y£a. yanow&ismorniqgay aygat yanow ayasepowstag£dapits£vin8erdiy naygadap nEnaystardfuwknarawn aenntn 240 THIRD GRADE was supposed to be dressing then I start fooling around then its five after eight and Im supposed to leave at fifteen after and then I only have ten minutes so I start rushing and I finally get through. At um fifteen after. Made it though. Um well todays my moms birthday and it was last year on the twenty second and um forty year it was um forty forty one years too. It was forty years before. INFORMAL SPEECH 241 ?ayesepowstebiyditsiq6Cnay starfuwliqerown &£nitsfayv«ftercyt enamsepowstoliyvet fiftiynaefteren&cnaownliycvtcnminissowaystart re/iqnayfaynliygiOruw. ae? ?em fiftiynaeftar. mcyditdow. ?em wEltedcyzmaymamzbsrOdcy Eni?wez laestyiyron&atweniysfkin ?aend ?em fardiyyiyr ?i?wez ?em fardiy fardiy wenyiyrztuw. zwezterdiyyiyrzbiyfor. 6.31 LETTER TRANSCRIPTION-FIFTH GRADE 6.02 PHONEMIC TRANSCRIPTION—FIFTH GRADE 244 FIFTH GRADE Well um I have uh one sister. And um shes five and shes in high kindergarten. And my father has um a business called em and em pipe and supply and um hes just retired from the air force. Um no well on his um when he went to check on some pipe like when um they knocked down that smelter in Arizona copper smelter. Well we went uh he went down there to get some scrap metal um we went with him. Um we um passed um Jerome Arizona its a ghost town. And uh um we saw they um there are about um fifty families there. And um there used to be about one thousand five hundred. And um when we got to Sidona um they um um have fishing a lot of fishing and every Friday they have seven thousand fish that they dump in you know oak creek canyon and um so we were going to go Thursday but we stayed until Friday and um we tried to go fishing but we didnt find any fish and we were we asked them if theyd stop this some place I forgot what it was called and they said yes but I guess we got there too early and we couldnt wait so we had to go home. It was. Five days. Well I have a sister and shes eight and is going to go on nine shes in high third I think and my father is an attorney and that is why his newspaper his picture in the paper. Because he was a new one. A couple of years ago. And he has some criminal cases and everything we got to go to court and see him. Oh I got to go but we missed him there. We had breakfast there but we but we got into the courtroom too late. Oh we saw another case being tried though. No it was a divorce case. He did twice and we and we missed him again. Well I have an older brother thats going on thirteen and a younger brother that is seven and hell be eight. My big brothers in ae eight no bee eight and my fathers an insurance man. And we go camping about three times a year. Oh to lakes and the beach because we have a boat and so my dad likes to go away where theres water. Um hmm. I prefer swimming and water skiing. Uh um this um a couple of weeks you know um my friends Steven and Michael Baser theyre twins and they always go fishing once a week and theyre going to have a birthday April second and so were going um fishing on a half day boat. And last time we went fishing um um my mother me um the twins and their father went and Jack wouldnt touch a worm and neither would the twins and neither would I so my mother put them all on. And then when we went to clean the fish nobody knew how so she took a knife and she tried it and she got all the scales off. One popped in Michaels eye though. Um hmm. And then Michael tried and Michael went about two weeks ago caught and caught a perch his father did in the surf in the surf in the surf and um when he tried to clean it he was so afraid because when it was just having babies and he was cutting down the middle and then and so Steven tried to do it and then he took one look at something that came out INFORMAL SPEECH 245 w d e m ayhaeve wensister. aendam /izfayv en/izinehaykinegar&an. an mayfa&er haezam abiznaz kaldemenEmpaypenseplay aenamhiyzjes?riytayerd fram&iyerfowrs. am now w d oniz wcnty w£n?tuw CEkonsempayplayk w f n e m &cy nak?dawn &ae?sm£lterinaerizowna kapersmdter. w d wiywtnta hiy wEndawn&er teg£?sem skraepmctel am wiy went wiOim. am wiyam paest am Jarowmaenzowna itsa gowsTtawn. aende am wiyso &£yam &Er?erebawdem fiftiyfaemliyz&Er aedem fttryuwztabiy abawt wenOawzend fayvhendrEd. aendewanwiygaftasedowna em fttyamemhaev fijiq eladevfi/iq fijiqanevnyfraydcy 6£yhaev s£ven6awzendfij ftet&Eydempin yenow owkriy?kaenyen aendam sow wiywargowiqtagowdarsdcy betwiyst£y?tilfraydEy aendam wiytrayta gowfi/iq be?wiydidantfayndEniyfiJ an wiy aesktem if&cy stapt &is samplEysayfergatwe?etwazkold aend &Eys£dyes ba?aygcs wiygat&Ertuwerliy aen wiy kudenwEyt sowwiyhaetegowham. i?wez. fayvdtyz. w d ayhaevasistar enjiyz Eyt aenzga agowonnayn jiyzin hayOard ayOiqk aenmayfa&er izanatarniy aen&aets wayhiznuwzpEyper hizpikjarin&epcypar. biykozhiywezenuwwen. ekepele?yerzegow. aen hiyaezsamknminalkcysaz enevn&iQwiygaftegowtekortensiyem. ow ay ga?ta gow batwiymistam&Er. wiyhadbrckfast&er be?wiy be?wiy gat intuwftakortruwm tuwltyt. ow wiysoana&arkcysbiyigtrayd Sow. now itwazedivorskEys. hiydidtways an wiyenwiymistemegEyn. w d ayhaevenowlderbre&er&ae?ts gowinonOartiyn aeneyeijerbre6er 6aetiz seven hiylbiycyt. maybigbre&erz incycyt nowbiycyt aen mayfa&erzenin/uraensmaen. aenwiygowkaempiqebaw?6riytaymzeyer. 3m tuw Icyks an&abiyC biykozwiyhaevabowt ensmaydaedlayksstegow wcr&crzwoder. emhem. aypriyfer swim11] an watarskiyiq. eem ftisem e kepelevwiyks yenow mayfrendz stiyvenenmaykelbcyser bcyrtwinz aen&EyolwEyzgowfi/iQ wansewiyk aen&crgonehaeveberOdcy EyprilsEkend ensowwiyrgowiq em fijiqonehaefdcy bowt. an laes?taym wiywEntfiJiq em em may me&er miy am &etwinz en&Eyrfa&er went aenlaek wudentefiewermenniy&erwud&etwinz enniy&erwuday sow may me&er putem olon. aend &En wEnwiywEnte kliyn ftefij nowbadtyniyuwhaw sow Jiytukenayf en/iytraydit en/iyga?9l&esk£ylz3f. wenpaptinmaykelzay&ow. emhem. en&Enmaykeltrayd enmaykel w£n?ebawt tuwwiyksegow kot en koteperC hizfa&erdid in&asarf in&eserf in&asarfaendem weniytrayte kliynet hiywassowefrcyd kezwen t?wazjes haeviqbEybiyzaenhiy wezkatiqdawnbamidal aen&En aensowstiyven traydeduwet aen&Eniytuk?wenluketsempin &ae?k£ymawt 246 FIFTH GRADE and yet their father was doing it. And then their father tried to and Michael she he was showing Michael how not to you know he might cut himself. So he starts doing this and he make and he cuts himself all the way around the thumb. Because here he was telling Michael to be so careful. One about four or five month ago my father he had never seen pee oh pee. And so we went into pee oh pee it was about an hour before it closed and so um he tried um to get these balls in the thing to win something for my sister. And then she tried it and the man moved a little closer for her and she got it in. And um we went on um this um ride. Its um the bubble. I dont know I dont know what it is it goes under water its like it is shaped like this and it goes underwater you go in and there are a bunch of fish and then when you come up and then you sort of go down again back in. I mean it feels like your stomach got taken away. Well the day before Christmas we went to Disneyland and we went to the hotel and then we went um under under the water in the big submarine and then you would see these mermaids going like that. And then you see this big octopus hes practically covers the whole submarine but we get away. And then then when we come to the surface we get off. Then we went on um the the Matterhorn I think its called and you go then you go through this water place under it right here its splashing on to you. You get all wet. A couple of Saturdays ago I went to Mount Baldy and they didnt tell us to bring a dollar for the ski lift that went three miles up hill. And so all the kids that didnt bring their dollar had to hike up hill. And I lost half my lunch going up. Because we kept slipping over rocks and it started to snow half way up and it was deep snow. It was horrible. About three miles up and you kept slipping on rocks. We got up there and had some tea and most of the kids went over and sat by the fire but my friend Judy and I went out and had snowball fights with the rest of the boys. Your feet were were so cold you know. It wasnt cold because you got plenty of exercise but going up that hill it killed me. A lot of kids one came up like this and a ski patrol man had to go down and get her and wrap her up in blankets and take her in by the fire. Another .girl came up with a frozen hand and another girl she started to faint or something she just about fainted and they had to go half way all the way down the hill they had gone half way up again and they said for anyone who has a fast pace to go on ahead theyll be right behind us and my friend and I we hike well all over the place on these railroad tracks and so we were used to it and we hiked ahead and they went all the way down the mountain again. And we kept hiking up and a cloud came in and you couldnt see three feet ahead of you. And we got up to the top and no one was there and they didnt come up for about a half hour. Uh huh. In fifteen minutes it was INFORMAL SPEECH 247 aen yet 6er fa&er wez duwenet. aen &En &Eyrfa&ertraydtuwaenmEykel JiyhiywazJowiQmaykel hawna?tuw yenowhiymaytkedimsElf. sowiystar?tsduwiQ&is s n i y m x k antykats himself 3l6ewEyerawn&e8em. koz hiyr hiyweztElinmEykel tabiysowkErfal. wan ?ebawt fowrar fayvmenGegow mayfa&er hiyhadnEvarsiynpiyowpiy. aensowwiywEnintuwpiyowpiy twaz?abawtanawrbiyf3ri?klowzd aensow am hiytrayd am tagEt&iyzbalzin.&e 8113 tuwansampanarmaysistar. aen&EnJiytraydet aen&emaen muwvdelidelklowserfarer aenjiygatetin. aendem wiywtnon am &is am rayd. its am &e babel, ay down now ay down now watetiz etgowzenderwader itslaykits /Eyptlayk&is aenetgowsenderwader yuwgowin en&are benCevfiJ aen&Enwenyuwkemep aen&cnyuwsortovgowdawn egEnbaekin. aymiyn itfiylz laykyerstomekg&£na?tEyken ewEy. wEl ftedEybefarkrismes wiywEnte dizniylaend aenwiy w£ntuw6ehowt£l aen &EnwiywEn?em ender ender ftewoter in&ebigsebmeriyn aen6£nyudsiy&iyzmarm£ydz gowiqlayk&aet. aen&Enyuwsty 6is bigaktepes hiyzpraektikliykeverz&ehowlsebmeriyn ba?wiygEtew£y. aen&en &Enw£nwiy kemtuw&eserfes wiygttof. fttnwiy wEntonem &emaetehowrn ayOink itskold an yuwgow &En y u w g o w Gruw&iswoderplEys enderet raytiyr i?tsplaejiq ontuwyuw. yuwgEtslwet. ekepelavsaeterdEyzegow aywEntah mawn?boldiy aen fttydidan teles tebnqedalar for&askiylift &ae? wEnt Qriymaylz aphil. aendsowal&ekidz &e?dtden brirj&Eyrdaler haete hayk ap hil. aenaylost haef may lent gowiq ep. kozwiykEptslipiQowverraks enetstar?edtesnow haefwEyep aenatwaz diypsnow. twazharebel. ebawtdriymaylz ep enyuwkEptslipirpnraks. wiyga?ep&Er enhaed semtiy aen mowstov&ekidz wEntaveraensaetbay&afayr be? mayfrendjuwdiyanay w£n?awtenhaed snowbolfayts wi&erEstov&eboyz. yuwrfiytwer wersowkowld yenow. i?wazen?kowld biykozyuwgatplentiyov Ekzarsayz bet g o w i q e p 6aet hil i?kildmiy. eladev kidz wenkEymeplayk&is aena skiypetrowlmaen haete gowdawn aengtter aenraeperepinblaeqkEts aen tEykerinbay&efayr. ene&ergerlkEymepwi&efrowzenhaend aen ena&argerl Jiy ster?etef£ynt3rsem0iq JiylestebawtfEytad aen&Eyhaetegow haefwty ol&ewEydawn&ahil AEyedgan haefwEyepegEn aend &EysEd for EniywenhuwhaezefaestpEys tegowonehEd ftEylbiyraydbehayndes aenmayfrEndaenay wiyhayk wEblowvar&eplEyson&iyzrEylrowd traeks ensowwiyryuwzteit aen wiyhaykt ehEd en&EywEntol&ewEydawn&a mawtenagen. aenwiy kept haykinap aene klawdkEymm enyuwkudensiydriy fiytehEdeyuw. aenwiyga?apte&e tap ennowwen wez &Er en&Eydiden kemep ferebawtahaefawr. aha. infiftiynminets 248 FIFTH GRADE a couple of feet deep. I I have uh I had a dog named Misty but it was so big we had to give it away. Urn it was half um half poodle and half something. This um woman I forgot her name took her exclusive poodle up to a ranch you know. And she must have met a dog and she had these you know and she got these dogs. And so my uncle um Joe he he knew her and uh he gave her seven puppies. Five puppies. And so um one my uncle Joe kept and one uncle Eddie took and um I forgot and one we gave to my grandmother and one to us and I forgot who the other one. Got the other one. But anyway the first day my grandfather brings it over we didnt know he had them in the pockets of his coat and when and then you know they were so cute and they were so small like a white snowball and you couldnt see their eyes it was just hanging over so then in three, months he was this big and seven months he was this big and pretty soon whenever I stood up and he you know hed like to play a lot and get exercise I couldnt keep a hold of him and my sister man hed jump up and be about that much taller than her and come down right on her head. And he was everytime he jumped up at me you know and try to get on top of me hed scratch me. When he was when he was so big he tore up the furniture. When we let him in the house I was laying on the couch you know and Terry was going outside and he got in the house and you could hear his feet I started to get up and he jumps on me. I couldnt get up. He weighed about sixty pounds. And then you couldnt see his eyes or anything. It was the biggest one of all. And my um grandfather when we took him over um they met you know. They um um Jock was the grandfathers um my grandfathers um dogs name. And so when we take him over instead of Jock you know they like to fight and play instead of Jock um uh fighting him with his pores paws Jock would take his foot and dig up dirt and throw it at him in the eye. Hed dig it. ltd go right in his face. Anr* then when you tried to stop them you know theyd both go on you. And um my grandfathers one man he had a a longer nose. Yeah I have a dog and when she was little she had to have take some kind of pills. I dont know what they were when she was a puppy some kind. My dad gave them to her. And one night he was trying to give it to her and he got it down there and she wouldnt swallow it and she coughed it up and she ran away and there was just a tiny little opening through my couch between the wall and she ran behind the couch and she wouldnt come out. And my dad had to move all the furniture out of the way and then he had to move the couch out of the way and get her. When I took uh Misty to um when we took Misty to get a shot to a the veterinary or whatever it is. He um was going up to get his shot and the doctor was over getting this thing and he jumped out of the other doctors hand and he ripped the doctors coat direct down the back and then sort of hung on and then he and then this other dog um who was who was about INFORMAL SPEECH 240 i?weze kepele fiyt diyp. ayayhaeve ayhaededag ncymdmistiy betetwessowbig wiyhaetegi vetewiy. um i?wez haef em haef pudel enhaefsemOm. ftisem waman ayfergoterncym tukereksklusevpuwdel ep tuweraenC ye now. aen Jiy mestemcte dog aen Jiyhaed&iyz yenow aen&tn Jiygat&iyzdogz. aensowmayeqkel em Jow hiy hiy nyuwher aende hiygcyver seven pepiyz. fayvpepiyz. aen sow em wen may eqkellowkcpt enwen eqkelcdiytuk aendem ayfergst huw aenwen wiygcyvtemaygraenme&er enwentees aenayfergot huw biye&erwen. gatftiye&erwen. betcniywcy fteferstdcy may graenfa&er bni)zi?owver wiydidannow hiyhaedem in&apakatsovizkowt aenwen aen&Enyenow ftcywersowkyuwt enfttywersowsmol laykewaytsnowbal aenyuwkudensiy&Cyrayz etwez Ies?haengiqowver sow&cnin OriymenOs hiywaz&isbig aenscvenmenOs hiywez&isbig enprtdiysuwn wcncveraystudep aenhiy yenow hiydlaykteplcyelat eng£?£kzersayz aykuden kiypehowldevim enmaysister maen hiydlempepen biyebawt&ae?me£t3ler baenerenkemdawn raydsnerhcd. aeniywez £vnytaymhiyjamptepae?miy yenow entraytegEtontapevmiy hiydskrae£rmy. wcnhiywez wcnhiywezsowbig hiytowrep&eferniCer. wcnwiy ledem inftehaws aywezlcyiq an&ekawCye now aentfriy wezgowiqawtsayd aeniygat in&ehaws aenyuwkudhiyrtuzfiyt aystar?eteg£tep aemyjempsonmiy. aykuden gctep. hiywcydebawtsikstiy pawndz. aen&cnyuwkudensiyhizayz ercniOig. etwez&ebigestwenovol. aendmay emgraendfa&er wcnwiytukemowverem &£ym£t yenow. &cy em em Jak wez&egraendfa6erz em may graenfa&erz emdagzncym. ensow wenwiytcykem owver instcdovjakyenow ftEylayk tefaytenplcy instcdovjak em eh faytinemwi&hizpowrzpoz Jakwudtcyk hizfut endigepdertenOrowetaetem indeay. hediget. itedgowraydinizfcys. aen&En wcnyedtray te stepem yenow ftCydbowO gowonye. aenemmay graenfa&erzwen maen hiyhaedeebqernowz. yea ayhaeve dog aen wcnjiywezlidel Jiyhaede tcyk semkaynde pilz. aydownnowwet ftcywer wenjiywezepepiy semkaynd. maydaed gcyvemtuwer. aenwennayt hiyweztrayn tegivettuwer aenhiy gatet dawn &Er enjiywuden swolowet aenjiykoftetep enjiyraenewcy aen ftcrwezjese tayniylidelowpeniq 6ruwmaykaw£ biytwiyn&ewol aen Jiyraenbiyhaynd&akawC en/iywuden kemawt aenmaydaed haetemuwv olftefernifier awtev&ewcy en&cnhiyhaete muwv 6ekaw£ awtev&ewcyengcter. wenaytuk eh mistiy tuwem wen wiy tuk mistiy tegctejat tuwe ftevcterenaeriy orwetcver i?iz. hiyemwez wezgowiqep tegctiz fat aen bedakter wezowver gctin&isOiq aen hiylempt awtev &iye&er dakterzhaend aeniyript ftedakterzkowt dercktdawn&ebaek aen&cn sarteheqon aen ftcnhiy aen&cn6ise6erdowg em huwwez huwwez 250 FIFTH GRADE Mistys size started barking at him and then he was taken given a shot. And then here comes this little chihuahua and he was barking at Misty and going up right eye to eye and Mistys backing off. Yeah but they Misty was only a puppy because he was only seven months old six months old. And the chihuahua was probably about two. And um my sisters girlfriend she has a dog that was supposed to be all chihuahua but its a little bigger than a chihuahua about that big and so when we brought Misty over to see the dog she didnt she um her name was Peppy and she never saw anything like it you know couldnt see her eyes or anything and she started backing off. Well weve got four people in our family and the dog and my sisters sick right now. Shes got a um shes got a cold and she also has a um throat infection. My dogs a shaggy dog. Well I got three people in my family my mother my sister and I and my sister is not going to school today she has a cold and my mother shes assistant bookkeeper for this man named mister Lopez. And I have four people in my family. And my sister doesnt go to school yet because shes only four. And got two gold fish and um my dads a fire prevention engineer. Uh you plan check schools you know see if theyre safe. Well my dads a um a cee pee ae. Certified public accountant. That has um they have to be real good in arithmetic. Thats all I know. Um if I have any problems in arithmetic I can just go home and ask him. Well um I horseback ride um um um a lot. I mean in the vacations and everything. Well be moving to Encino this summer and we got a swimming pool and its three quarters of an acre and its big. Yeah its hot. I wish I did. Well I like my favorite sport is skin diving I like to do it during the summer. Well um Im going out with a friend big brother its a association for boys who dont have fathers and were going to go to Catalina Island skin dive around there and take pictures. No I usually went around here. Well you you have to breathe well its really scuba diving. Skin diving is just with a mask and the fins and this little thing that goes out of a mask and well in scuba diving you have to you can only breathe through your mouth. You have a lung that comes from the air tanks. You breeze you breathe in that. Well you can see good because you have the mask on. Plants and things if youre out far enough. No we just just do it for fun. Well I go to the beach most of the time. And um well my friend um my mother likes to go to the beach a lot so she take us takes us to the beach. And um play baseball and stuff like that. We live in an apartment so you cant do much. This summer the coach was trying to um teach me how to play baseball cause I like I like to play football. But um playing baseball I dont I dont know um I cant hit it very far yet but uh its coming. Yeah. Well um um I um like to swim. Um I like to play chase. Hes good. INFORMAL SPEECH 251 ebawtmistiyzsayz star?edbarkinaedem aen&enhiywez teykengivanejat. aen&en hiyrkemz 6is kdelfiiwawe aenhiywezbarkin x?mistiy aengowiqep raydaytaay aenmistiyzbaekinof. yea be&ey mistiywazownliyapapiy kazhiywez ownliysevenmenOsowld siksmsnOsowtd. aen&e Ciwawewezprababliy obaw?tuw. aendam may sistarzgerlfrcnd Jiyhaeze dag 8e? wezsapowzdtebiyolCiwawa bedetselidelbiger&ene iiwawa abaw?6aetbig aensow wtnwiybrot mistiy owvertasiy 6a dog Jiydiden Jiyam herntym wazpepey anJiynevarsaCniyOiqlayket yanow kudensiyharayzareniyOiq anjiystar?ed baekinof. w£l wiyfgotfowrpiypelinarfaemliy sen ftadog an maysistarzsik raydnaw. Jiyzgataam Jiyzgatekowld en/iyolsow haezam Orowtinfekfen. maydagza/aegiy dag. welaygotOriypiypelinmayfaemliy may me&er may sistaranay an maysistarz Jiyznatgowiqtesmisterkuwltadey Jiy hazakowld enmayme&er Jiyzasistant bukiyper far&ismanncymd lowpaez. anda ayhavfowrpiypelinmayfamky. and maysistardazentgowtuwskuwlyet biykozjiyzownliyfowr. and ga?tuwgowldfiJ aend am maydaedzefayrpriyvenjenenjiniyr. ah yuwplan£ekskuwlz yuwnow siyif&eyrseyf. wtl maydaedzeem esiypiycy. sartafaydpablikakawntant. &a?haezam bcyhaeftebiy riylgud inanOmatik. daezawlaynow. amifayhaevcniyproblamzinariOmatik aykanjas gowhown anaeskhim. welemay howrsbakrayd emamem slat, aymiynin&evekcy/en anevnyOiq. wiylbiymuwvmtuwensiynow&issemer anwiygataswimiq puwl ntsOriykwarterzoveneyker anitsbig. yea itshat. aywijaydtd. waw aylay? mayfeyvritspowrt izskindayvin aylayktaduwat duwriq&asamar. wew aym gowiqawt wiOafrend bigbra&ar itse asowsiyeyjan far bayzhuwdownthaevfa&arz anwiyrgsnegowtekaeteliynaayland skindayverawn&crentcykpiCerz. now ayyuwialiy wenarawnhiyr. wawya yuwhaeftebriyft wtl itsrtyliyskuwbadayvin. skindayvinizjast wiOemaesk an&afinz an&islidel Oiq&aet gowzawtovemaesk and wel inskuwbadayvin ya haevda yakenownliybny&Oruw yermawO. yuwhaevelaq &aetkemzfrem biyer taqks yuwbriyz yebriy&in&aet. wel yuwkansiygudbiykoz yuwhaev&amaeskan. plants enGiqz afyarawtfaranaf. now wiy Jast Jest duwitferfan. wel agowtuw6ebiy£ mowstov&etaym. an am wewmayfrend am mayme&arlaykstegowtuw6ebiy£alat sowjiyteyksas tuw&ebiy£. and em pleybeyzbol enstef layk&aet. wiylivanenapartment sowyuwkaentduwmeC. ftissemer 6akow£ weztrayiqteem tiyCmiy hawteplcybcyzbal keaylay aylayktapleyfutbol. bat am pleyinbeyzbol aydan aydownnow em ay kanthitat venyfaryet bate itskemiq. yea. wel emem ayam layktaswim. am ay laykteplcy&eys. hiyzgud. 252 FIFTH G R A D E Hes really good. Hes funny because urn once we were in the middle of I think it was arithmetic or reading. And Mitchell Sperling said you sound like um what is it Jackie Gleason and he and mister and he stops in the middle of it and he talks about the show. And he says um the guy I like the best is crazy he walks in and goes hello Joe. And um he starts singing um and I like him because well hes kind of hard but hes funny and stuff. Hes hard but hes really funny and uh I like mister uh Anton. But he comes along and he hes when he comes through the door he stands real uh real real quiet its real funny. I I dont like old I dont like I didnt like any of our social teachers I mean I mean the um substitute teachers that much. I liked it better when mister Palbaum was here because theyre they dont know anything what were going to do or anything. When when we had our substitute I think it was Tues uh last Tuesday. And and we at five to ten we all made a big cough. Everybody passed around the room. The teacher didnt mind but then some of the guys you know they started to sneeze and yawn. We were going to whistle but um we decided that it wouldnt be such a hot idea. So everybodys was doing it and some of us Marvin I and I dont know some other guys they could whistle we were just sitting there you know we werent doing a thing because you know they were sniffing or they were coughing we did the cough and we did the sneeze but we didnt do the sniff. Everybody and everybody was saying five minutes left they were yelling it out and everything. And they were going four three two one and then they were counting down. And Peter he was he ran out of the room because he couldnt hold it any longer. He went out and sneezed. And he gets into a lot of trouble. And we might move um I dont know where but we might move in June after school lets out. Yeah thats when were going to move because mom doesnt want to pull us out of school. Yeah and um um I want to move down up to either in Malibu or some beachhome or something because I like the beach a lot. I like to live down by Malibu too. I sort of like to fish a little but I havent done very much. But were not going to move from here for a long time. Were always moving around we live at one place for a year and then move and we planned on living here about five or six years or something like that. Hes really the best teacher because hes hes hard and also hes he makes you understand. And like he explains things like no other teacher I know. Another teacher you know they walk in and they say um and theyll give INFORMAL SPEECH 253 hiyznyliygud. hiyzfemy biykoz wanswiywar in&emidelov ayOiqkatwaz eriOmstik orriydiQ. aenmitalsparliQsed yuwsawhdlaykem watizat Jaekiygliysan aeniy aenmister aeniystapsinftamidabvat aen hiy toksabawt&ajow. aenhiysez am &agayaylayk6ab£st izkreyzy aeniywoksanaengowz ewuwjow. aen am hiystartssiqiq am e n d aylaykim biykoz wdhizkaynahardbat hizfeniyanstaf. hiyz hardbat hiyzriyliyfaniy an ah ay laykmistareh aentan. bat hiy kamz aloqaenhiyhiyswCniykamzOriiw&ador hiystaendz nylahriylriylkwayEt itsriy?feniy. ay ay downlaykowld ay downlaykaydinetlayktniyeversowjeltiyierz aymiyn aymiyn &aam sabstityuwttiyCerz &aetma£. aylayktatbedar wanmistarpaelbam wazhiyr koz&cr fteydown nowcniyOiq wadwiyrgonaduw areniyOiq. wen wen wiyhaedarsabstituwt ayOiqkatwaz tuwsah laesttuwsdEy. aen aen wiy ah fayvtatcn wiyolmcydabigkof. Cvriybadiypaest arawn6aruwm. 6atiy£erdidenmaynd bat &£n bat&cnsamov ftagayz yanow ftcystartad tasmyz enyon. wiywargona wisal batam wiy diysaydad &a?it wudanbiysaCehataydiye. sowEvriybadiywazduwinit ansamaves marven ay anaydownnow sama&argayz ftEykudwisal wiywaijassitiq&Er yanow wiywcran duwigaOiq biykoz yanow fteywarsnifiq er ftcywarkafig wiydidftakaf aend wiydid ftasniyz batwiydidanduw&asnif. Evriybadiy aencvnybadiy wazsEyiq fayvminatslcft &EywaryElam?awt aenEvriyOii). aen&Eywargowiq fowr 8riy tuw wan aen&£n6Eywarkawntindawn. aen piytar hiywaz hiy raenawdav ftaruwm koziykudanhowldat Eniyloqar. hiywEn awtansniyzd. aen hiygetsintuwalada trabal. aen wiymaytmuwv am aydown nowwEr bat wiymayt muwvanjuwn aeftar skuwlletsawt. yea Aaetswanwiyrgsnamuwv kozmen dazanwanapulasawdav skuwl. yea aend amamay wanamuwvdawn aptuw ly&armaelabuw arsambiyfi howm arsamOiQ koz aylayk&ebiielad. aylayktalivdawnbay maelabuw tuw. aysortalayktafij alidal batayhaevantdan veriymai. batwiyr natgonemuwvfremhiyr faraloqtaym. wiyralwiz muwvanarawn wiylivatwan pleys farayiar aen&enmuwv aenwiyplaendon livinhiyr abaw? fayv ar siks yiarzar samOin layk &aet. hiyzriyliy&abtsttiyCar biykoz hiyz hiyz hard aen o I sow hiyz hiymeyksyaandarstaend. aenlayk hiyaksplcynz 8IQZ layknowa&artiyCar aynow. ene&ertiy£er yanow Aeywokin aen&eysey am aen 254 FIFTH GRADE you all the they wont give you any facts they say you have to dig up all the stuff. But mister Palbaum you know he um if you ask a question like um is Cana is um lets say um oh British Columbia northeast and you know hed tell you and hed explain to you the directions and hed show you um what longitude and latitude lines itll be on and if you were wrong he you know would explain it up but if were right hed say very good tine um could you show me where um lets say Dawson is. Um what their longitude and latitude lines are. And hell just tell you what to do and and hed explain it to you but uh other teachers they just well not all of the other teachers but some teachers like if you said um is British Columbia northeast theyd say well what do you think. Theyd just go on to another person. But he just stops and explains it to you. Thats why I like him. He can be funny as well as be serious. Um today you know when I you know made the top groups he learns what class er bee with bee sixes. And um he says all right um and then he made a great big ex on my thing. A plus. And um if you know some teachers you know if theyre serious or serious and there are always serious and theyll never do anything to be you know funny or happy or something. And some teachers are always happy and theyre cracking jokes. You get kind of bored of it you know they go um some teachers are real serious you know they wont they wont even give out a smile. But he you know hes half smiles half frowns. Hes really happy. Oh uh one of the girls from room ten brought him a little baby bottle. He just had a baby. His wife just had a baby. He doesnt let you raise your hand. He makes you sit sit up if you know the answer. And if you raise your hand he says youre waving at me this morning. Denny half the time shes going like that. You know hed stop you know if you were sitting up real good real straight. Hed um you know hed call on you. But if you were you know waving at him hell go hello I see you now and other guys will wave at you. But the minute you wave at him hell just stand there and hell wave back at you or something. But hell never call on you. And in a way I dont like that because lets say somebody like um lets say theres this student like Randy. He sits up a lot you know straight but he isnt that smart. Oh that isnt nice Steven. Well he hes hes smart yeah hes smart but he wont give the answers. And he sits up a lot and he actually embarrasses you know because youd say um yes Randy and hed be sitting there you know and he wouldnt say anything. Hes looking up at him. Because this guys real tall. Uh every time Billy raises his hand hes going like this on his head. He goes like this when he gets the wrong answers. INFORMAL SPEECH 255 ftcylgivye olfte ftEywowngivya Eniyfaekts fttysty yuwhaftadigap ol&e staf. bemistarpaelban yenow hiy am if yeaeskaekwE/ien laykam izkaenaizl£?ss£y am ow britijkolembiya nowrOiyst aenyenow hiyd tElye aenhiydEksplEyntaya ftadarEk/anz a n d hiydjowya em wetbqityuwdenlaetetyuwdlaynz itelbiyon aendifyawerroq hiy yanow wudaksplEynetap batifwarrayt hiydsEy vEnygud fayn am kud yuw/owmiy wEr am lEtssEy dosaniz. em wet&Eyrbqityuwdenlaetityuwdlaynz ar. aenhiyljestulyawateduw aen aend hiyd EksplEynatayuw bataha&artiyCarz dcyjast wElnatobv&a e&ertiyCerz bet sam tiyCarz layktfyuwsEd amizbritiskolambiya nowrfhyst ftEydsEy wElwadayuwOiqk. 6Eyd Jestgow antuwana&arparsan. bat hiy Jaststaps eneksplEynzit tuwye. Aaets wayaylaykam. hiykenbiyfeniy ezwElazbigsiyriya. am tuwdEy yanow wanayyanowmEyd&atap gruwps hiylernswetklaes erbtywiObiysiksez. aenem hiysEz owrayt an &En htymEydegrEytbigEks en may 6iij. a plas. aenem ifyanowsemtiyfierz yenow if&Eyrsiyryes ersiyryas aen&Eraralwizsiyryas en 6EylnEverduwEniy6iQtebiy yanow faniyer haepiyer semOin. aen semtiyCarzer olweyz haepiy an&Eyrkraekiq Jowks. yuwg£?kayndabowrdovit yuwnow ftEygowam semtiyCerzernylsiyryes yanow &Eywownt AEywowntiyvengivawtasmayl. bethiy yenow hiyzhaefsmaylz haeffrawnz. hiyzriyliyhaepiy. oweh wanav&agarlzframruwmtEn brotamelidalb£ybtybadel. hiy JeshaedebEybiy. hizwayfjest haedebEybiy. hiy dezentlEtyuw rEyzyerhaend. hiymEyksyesitep aen ifye now&iyaensar. ifyuwrEyzyarhaendhiy s£z yarwEyviq ae?miy Aismarniq. demy haef&etaym Jiyzgowiqlayk&aet. yanow hiyd stapyanow ifyuwwarsitiqep riylgud nyl strEyt. hiydem yenow hiyd kabnyuw. betifyuwwar yanow wEyviqaetem hiylgow halow aysiyyanaw aendeber gayzwalwEyvaetyuw. bat baminetyuwwEyvaetem hiylJaststaend&Er aenhiyl wEyvbaekaetya arsampen. bethiylnfvarkobnyuw. aen inewEy aydownlaykbaet biykozlEtsEysembediy tayk em IstsEy&Erzbistuwden layk raendiy. hiysitsepelat yenowstrtyt bethiyizent&aetsmart. ow baetizent nays stiyven. we I hiyhiys hiyssmart yEahiyssmart bethiywongivbiyaenserz. aend hiysitsepelat aend hiyaek/eliy embEresez yenow biykaz yedsEy em yEsraendiy aen hiydbiysitiq b£r yenow aenhiywudensEy Eniydiq. hizlukinapaetam. koz ftisgayzriyl tol. eh EvnytaymbiliyrEyzashizhaenhizgowin layk bis an hiz h£d. hiy gowzlaykbis wEnhiygEts&aroqaenserz. 256 FIFTH GRADE He goes like this he says now thats a good question. Um. Oh hed say um Billy how much is twenty six times forty eight. And hed sit there you know finally he says thats a good question. You know hes sitting here and then hes going like this and hes writing it down on his paper. And he says mister Palbaum you know he snaps off the answer. He says oh yeah. Well what was it. What was the thing. Youre supposed to pick these three basic things and you have to and you have to pick out. No the basic shapes. Theres a square circle triangle and rectangle. Well we have I have a brother and a sister. And my little brother is my brother is younger than I am. Sos my sister. And we do a lot of sailing and swimming things like that. Well we have two oh two small boats. We might get a bigger one. And Sunday we went sailing. We went Saturday too. And we have a seventeen foot sailboat and eight foot sailboat. And Ive got a brother I mean not a brother I mean a sister. But anyway um I uh I started wearing glasses when I was in the first grade. And uh and in the bee fifth I started wearing contact lenses. And uh and I and I like the old wooden boats like um the Victory um and the um Old Iron Sides and things like that. Thats about all. Well Ive got a little brother and a big sister thats married. And my mother she used to teach ballet and Ive taken up ballet. So I take ballet and plan to have that my career. Did you know that I play the clarinet and piano. I knew you played the clarinet. Well the the piano about three years and the clarinet about three months. Im taking the piano about four years and ballet about two and a half. I got blisters on my feet. And Billy stepped on them today. He stepped on my toes today. But she is but she isnt so light. My family likes sports a lot. My dad likes to drive. I have a surfboard. Well I do. But Steven doesnt have a surfboard. And I go swimming down the street. Our friends have a swimming pool about every day during the summer. Jay. You saying that you go swimming down the street. I could make a pun on that. My friends swimming pool. You ever try poolswimming on some concrete. I used to have my own room before my little brother moved in and then were getting my room refurnished and weve got bunk beds and a tee vee in our room. We dont have a television. INFORMAL SPEECH 257 hiygowz layk&ishiysEz n a w &aetsagudkwEj£an. am. ow hiydsEy am biliy hawmadiz twcntysiks taymz fowrtiycyt. xndiydsitftEr y a n o w fayneliy hiy s£yz ftaetsagud kwCJCan. yanow hiysitiqhiyr aen&tnhiyzgowiQlayk&is anhiyzraytinat dawnon hiz pEypar. xnhiysEz m i s t a r p s l b a m yanowhiysnaeps af&iyaensar. hiy stz ow y£a. w£w watwazat. watwaz&aOiq. yar sapowzd ta pik &iyz 8riybEysik8iqz anyahaevta x n yahaevtapikawt. now&abeysik Jeyps. fterzaskwcr sarkal trayEqgal x n rxktEqgal. wEawwiyaev ayaevabra&aranasisdar. aenmay lalbra&ar iz may bra&arazayaqgardannayyaem. sowzmasisdar. x n d wiy duwwaladavsEyliqxn swimii) qzlayk&aet. wCa wiyhaev tuwow tuwsmolbowts. wamaytgcdabigarwan. s n sendtywiywinstyliQ. wawansaedardcytuw. x n wiyaevasEvantiynfutsEylbowtan cytfutscylbowt. xnayvgadebra&ar aymiynnadabra&ar aymiynasistar. b e d t n i y w t y am aya ay startidwcringlaesazwenaywaz innafarsgrEyd. aend ?a aend inna biy fifOaystartEdwEriQkontaeklEnzaz. haene x n a y xnaylayk&iy?owldwudanbowtslayk am&avikdariy am xn&aamowldayransaydzan Siqzlayk&aet. ftaetsebawdol. w£I ayvgada lidalbradar s n n a b i g s i s d a r t s m x r i y d . x n mayme&erfiy yuwstetiyCbxlEyennayv tEykenapbxlEy. sowaytiykbxlEy anplxntahaev&x?maykariyr. didyuwnow&adayplEy&8klxranE?npiyxnow. aynuwyuplEyd&aklxnnEt. wEl&a 6 a p i y x n o w b a w t Briyyiyrz an daklxrinct bawt Griymants. amtEykannapiyxnowabawtforyiyrz an bxlEyabaw? t u w w a n a h x f . aygatblistarzomayfiy?. anbiliyst£ptonemtid£y. hiystfptomaytowztidiy. bat/iyiz batfiyiznsowayt. mayfxmliylayks sportsalat. maydaedlaykssedrayv ayevasarfbord. wElayduw. ba?stiyvendazennaeveserfbord. xnnaygowswimiqdawnnastriy. arfrEnzhaevaswimiqpuwabaw? EvriydEyduriq&asamar. jEy. yuwsEn&eCuwgowswimiqdawn&estriyt. aykedmtykepanonnaet. mayfrEnswimiQpuwI. yeEvertray puwIswimiQonsemkankriyt. ayyuwstahaevmayownruwm biyformaylidalbra&armuwvdin andEnwirgEdiy? mayruwmriyfarniJdenwiyvga?beqbEdzzinattyviyinarrum. wiydown?hxvat£lavi2an. 258 FIFTH GRADE Then our den we had my dad made shelves. He cut down the steel and everything for it. Then my dad a couple of months ago he got a new um tape recorder real big one. And then he got a new hi fi set. You know stereo and record player and tuner and everything like that. Not too long ago our living room was redone. Gee youve have about everything redone. Yeah just about. You got anything to say. My dad belongs to a yacht club. My moms an associate member. And Ive been to one of the meetings. Oh they discuss things and they give uh trophies to the soggiest person you know. Some people fall off the docks at some of the races and everything. Then sometimes they have raffles. And they have cookies and milk and coffee. My dads won a couple of trophies. My father plays tennis. I sort of play sometimes. I won Campfire honors playing tennis. I have a tennis racquet and I play a little tennis. And I play baseball and football. I have a football uniform. And I have a baseball uniform. Davy Coleman plays football. Yeah I know that. I broke my wrist once. Playing with playing around with this teenager. I once burned my wrist. Getting into some hot water. Also it sprained my ankle. Well just about everybody in our family rides bicycles. I have a racer. My mom has one. My little sister has a twenty inch bike. My brother has a tricycle a scooter and a wagon. And my dad rides my bike. My father rides his bike to work. We have two new cars. Ones a convertible and one has a sunroof. I dont like school. Same with me. Welcome to the club. Its a hassle. Yeah work work work recess work work work recess work work work another recess work work work time to get out. What are your favorite subjects. Lunch recess and getting out. I like spelling. I dont like arithmetic ooh. I like um spelling arithmetic reading and etcetera etcetera etcetera. I like when they play the record in the morning when the flag goes up. Somebody bumps into the record player. Oh I like chorus. And you miss social study. Except one thing about chorus when they have it two to three everybody else gets to run track and everything and they dont do any work. Yeah we ntiss physical education. Yeah they dont do any work. INFORMAL SPEECH 259 &EnardEnwiyhaed maydaed mEyd/Elvz. hiykadawnnastiylnEvriyOir) font, dcmmaydaed akaplamantsagowiygada nuw ?am ttypriykordar riylbigwan. an&anniygadanuwhayfaysEt. yenowsUriyowen rEkardplEyyer aen tuwnar EvriyOiqlayg&aet. na?tuwbr)egowar liviQrumwaznydan. Jiyyavhaevanaw?£vriyeir)riyd9n. y£h Jistbawt. yuwgadcniyOiqdascy. maydaedbiybQztuwayaPklab. maymamzanasow/iaPmcmbar. nayvbintawana&amiydiqz. ow&EydiskasOiqzan&Eygiva trowfiyz ta&a sagiyaspErsyanow. samptypalfolof&adaks atsama&a r£ysazann£vriy6ir). AEnsantaymzzEyhaevraefalz. ?aen ACyaev kukiyz ammilk ankofiy. maydaeds wanakepalevtrowftyz. mayfa&erplcystcnis. aysordaplEysamtaymz. ayankaempfayar?anarz plfyiQtEnis ayavatEnisraekat annayplEyalidaltEms. naypl£yb£ysbolenfu?bol. ayaeva fu?bolyuwnafor. aennayhaev b£ysbolyuwnaform. dEyviy ko wm an plEyzf utbol. yfaynowdae?. aybrowkmayristwans. pl£yirjwi& plEyiQarawnwiOistiynEyJar. aywantsbarnmayrist. gEdiqintasam ha?wadar. alsow?atspr£ymmayaeqkal. w£l IistabawdEvriybadiyinarfaemliyraydzbaysikalz. ayhaeva rcysar. maymomhaezwan. maylidalsistarhaezatwEniyinC bayk. maybra&araezatraysikal askuwdaranawaegan. aen maydaedraydzmaybayk. mayfa&ar ray?zizbayktawark. wtyaev tuwnuwkarz. wanzakanvardabal anwanhaezasanruwf. aydownlaykskuwl. sEymwa&miy. walkamtuwdaklab. tsahaesal. yea warkwarkwark riysEs warkwarkwark riysEs warkwarkwark naftarriysEs warkwarkwark taymdagcdawt. wedeyurfEyvara?sabjEks. lanCriysEsen gEdiqawt. alaykspEliq. ayown?laykari8matik uah. aylaykam spEliq qanOmatik nydiQ anaetsEdaratsEdaratsEdara. aylaykwEnnEyplEy&arEkardinnamorniQwEnnaflaegowzap. sambadiybampsinta&arEkardplEyar. olaykoras. aenyamissowjalstudiy. sEp wan0iqabaw?k3ris wEnnEyhaeva? tuwda&riy Evnyb8diy£lsgE?stuwrantraekanEvriy6iq an&£ydown?duww£ruywerk. yE wiymisfizikalEjakEyJan. y£? 5£ydown?duw£niywark. 260 FIFTH GRADE Yeah because theres not enough people in the class. I guess. Our house is four years old. We moved in during the summer. The other school we went I went to was twice as big as this had forty two rooms and had twice as big playground you didnt and you werent assigned to any area you could just go around anyplace. And there was no big yard no little yard. Uh I think 111 stay here. And in the first grade I was able to go all the way out you know to the far end of the playground. You like that school better. Or this school. I dont know. I left in the second grade and I dont really know. And we used to live a couple of blocks from the airport. Every time they had an air show my dad used to bring me there. Where they had missiles on display and everything. What airport. Clover Field. Father works there. Does. Well well my parents and I and my sister went up to Yellowstone National Park saw the geysers. This this summer pop will be working in uh Arizona I think it is up um on the Greatest Story Ever Told. Are you going to go up to Arizona with him. Hell already be up there. Well we went to Yosemite National Park during the summer. We drove up there and we stayed there about a week. And um when we went down to the valley you know you know the floor we were up higher than the valley where its much nicer. Then when we went down to the valley we we didnt even need a tent or anything. But up but up higher it was about freezing. Its cold. And then my dad claims he saw a bear one night. Digging into the trash can. Tina said they went up to Sequoia and she saw a bear every night and they were digging in the trash can. We went up to Sequoia about we got back the day before school started in September. Well um you know that movie the Greatest Story Ever Told I might get to work in it this summer. Well um you for the extras you get paid ten dollars a day. Do you know what aitch two oh two minus oh is. Like if you know what twenty two minus two is youll know what this is. Twenty two minus two is twenty. Well yeah okay. But um what is aitch two oh two minus oh. Its aitch two oh water. Thats the only thing I can think of. Well um Mariner two reached Venus December fourteenth. Well you try and think of something else. Nancy how about telling us about girl scouts. Go on go on I was listening to Richard. INFORMAL SPEECH 261 yEabakazzfrsnaPanafpiypalnaklaes. ayges. arhaw? sizforyiyrzowld. wiymuwvdinduriQ&asamar. &iy?ebarskuwlwa?wEn? aywEntuwwaztwaysazbigazzis haedfordiytuwrumz aenhaedtwaysazbigplEygrawnd yadiPnt aenyewernesaynte?£niyyEriye yakaJusgowarawndEniyplEys. ?n&£rwaznowbigyar?nowlidalyard. aayOtQkalstcyhtyr. aennina farsgrcydaywazPeybaldagowol&awcyPaw? yanowta&a farcnda&aplcygrawnd. yelay?6e?skuwlb£der. ar&isskuwl. aydown?now. ayl£fdinas£kangr£ydnaydown?nyliynow. aenwiyyuwstuw livakapalablaksfram&iyEyrpart. £vriytaym&£yhxdan?EyrJowmaydsdyuwst8briqmiy&Er. wE&EyhaedrrusalzandisplEyannEvriyOii}. wadEyrpart. klowvarfiyld. fa&arwarksEr. daz?. WE I WE I maypaerantsanayammaysistar wEnaptayElestownsJanalpark so&agayzerz. bis bissamarpapalbiywarkiq in ?a aerazownaayOiqktdis Pap ?am on&egrEytstDriyEvertoweld. ayuwganagowaptaPaerizownawiOam. hiyblrEdiybiyyapbEr. wawiywEntayowsEmadiynae/analparkduriQ&asamar. wiydrowvap&Eraen wiystEyd&Erabawdawiyk. aendam wawiwEn? dawntabavxliyyanow yuwnowbafbr wiwaraphayarbannavaeliywar Pits meCnaysar. bEnwawiy wEndawnta&a vsliywiy wiydinniyvanmydatEnt orEniyOiq. badapba? Paphayar Piwezebawtfnyzig. skowld. aen&£nmaydaedklEymziysaab£rwannayt. digiqintabatrae/kxn. tiyna sabEywEnapta sakwayya an/iysa bEr EvriynayPannEywardigiQ inetraejkaen. wiywEnaptasakayya baw? wiga?baek6ad£ybiyforskuwlstardadons£pt£mber. wElam yuwnow baePmuwviy bagrEytastariyEvartold aymayPgEtawarkinit&issamar. wEl ?am yu far biyyEkstrazyagE? pEy?tihdalarzad£y. dyuwnowwat ?Ey£tuw?ow tuwmaynas ?owiz. laykifyuwnowwaPtwEniytuwmaynastuwiz yalnowwa?dbisiz. twEniytuwmaynas tuwiz twEniy. w£lya?owk£y. bs??em wa?n?iz?£y6tuw?owtuwmaynas?ow. itstyCtuwwow woder. ftaes&aownliyeiqaykanOtqkav. w£l?am maeranartuw riyitviynasdasEmbarfortiyne. walyuwtrayaneiqkasamOiqEls. naensiyhawabaw?t£liqasabawtgarlskawts. gowon gowon aywazlisannariCard. 262 FIFTH GRADE Oh I made the glider yesterday. Its tail heavy. Got to adjust it somehow or another. And now and urn the and the tape and its wings the the stuff Ive got over it is torn three times. And I dont know what Im going to do. You see you see the my main problem is whenever the the thing I cant adjust the elevators on the tail. Ive even got those to so that you see if only there was a way to make them work as its flying but cant. Do any of you play any instruments. Why Im going to I my sisters giving me accordian lessons and if I like it my mothers going to buy me an accordian. You see my sister already has one but moms going to buy me a littler one so that I can play on it. You know Bobby Corcoran he plays the accordian. We had a cub scout uh thing put on a show. Last year when I was still in the cub scouts I couldnt when I joined Hebrew but um. I quit girl scouts when I joined Hebrew. Um at west ell ae. I was at Temple Isaiah and then west ell ae. How about talking about something besides science. Well my bird is very cute. Huh he he him him he bites you all the time. And well my mother my mother feels like killing him because he eats the plants. We have no uh pets we had three dogs um because our friends went on a trip. And if we took good care of them wed get to keep one. It was the most the mischief mischievous one. So we took good care and we got to um keep him but then we had to sell him when we got the baby. We had some goldfishes but they died. We have no pets now. Oh Ive got three goldfish. I have two guppies. I had a plant I have a plant so um with my friends syringe Id I I made this stuff with my chemistry set and mixed it all together then I heated it then I then I injected it into the plant the plant didnt last three days. I just wanted to see what would happen. An atom do you know what an atom is made up of. Oh recently just in the last few years they found this something smaller than than electrons. Um pro something or sub protons I think they call them. You must have a whole library of science books do you. No. I go down the public library. Well about once every two weeks. Do you um do you always get books out on science. Well when we have to make a book report I get that besides them. Science is your favorite subject isnt it. Has been since I was five. What was before that. Playing toys. Naw. I was trying to learn how to spell. Did that succeed. Uh huh. But uh of course not like today. I could spell a few words. Well INFORMAL SPEECH 263 ow waymEy?&aglaydaryEstard£y. tstcylhcviy. gaduwa]asdi?samhawarna&ar. aennown aen am be aennatay?aennitswiqz 6a ftastafayvgadowvarttastornOnytaymz. aen aydanowwadaymganaduw. yesi? yasiy&a maym£ynprablam?iz wEnEv ba fteOiQaykaennaJasfte ?Elav£yderz onftatcyl. ayviyvan gat&owzta sow&a? yaOiyPiffownliy awazawEydamEyk&amwark aeziPsflayiqba? kaent. duwEniyavyuwplEyEniyinstramants. wayamguda?ay mesisterzgiviQmiy?9kDrdiyenl£sanz aend ifaylaykit maymadarzganbaymiyanakordiyen. esiy masisdarsrEdiyhaezwan baPmomzgebaymiyelielarwan sowftaykanplEyonat. yuwnowbabiykorkern hiypltyzftiyakordiyan. wiyaedakabskawd a 8iq padonajow. laesdyiyr hwEnaywaztilinakabskaw?s ayka?anw£nay]oyndhiybruwba? am. aykwitgarlskawtshwEnayJayndhiybruw. am ae?wEst£lEy. ayw8za?t£mpalayz£ye8n6£nw£st£l£y. hawbaw?t3kiqbaw?sam0iqbasaydsayins. w£l maybardizvEriykyuwt. ha hiy hiyhim himhiybaytsyuwolataym. aewa?mayma6ar maymadarfiylzlaykiliQim biykazziy?iyts6aplaents. wiyhaevnow ?ap£ts wiyhaedOriydogz am biykaz?arfr£nzw£non ?atrip. aen ?ifwiytukgudk£yravam wiydgttakiypwan. iPwazdamows AamisCaf nrusCafaswan. sow?wiydatukgudk£yranwiygata am kiypam be?&£nwiyhaetas£lamw£nwiyga?6eb£ybiy. wiyaedsamgowlfijaz ba?&£ydayd. wiyaevnowpEtsnaw. owwayvga?9riygowldfiJ. ayhaevtuwgapiyz. ayhaedaplaent ayavaplaentsow am wi&mayfrEnsarinjayt ay aymfydbistafwimaykEmastriysEPmiksdidoldagadar dEnnayhiydidit ftanay ftEnayanjEkdidinta&aplaent ftaplaendidanlaesOriydEyz. aylaswanidasiywaPwadhaepan. aenaedam dayuwnowwa?anaedammizm£ydapav. ow riysanky Jasdinnalaesfyuwyiyrz ftEyfawnnisamOiQsmalar&an 6aen ?iyl£ktronz. amprowsamOiq ar sab prowtanzaOiQ&akolam. yuwmashaevahowllaybEriyavsayansbuk duwyuw. now. aygowdawnnapabliklaybariy. w£l abaw?wans£vriytuwwiyks. duwyuw am duwyuw3wiyzg£?buksawd3nsayans. WE I wEnwiyaeftamEykabukriyport ayg£?6ae?biysaydzam. sayansizyafEyvartsabJikt izanit. haezbinsinsaywazfayv. wa?wazbiyfordae?. pltyiQtoyz. no. aywaztrayintalarnhawdaspel. diftae?saksiyd. aham. badaakors na?layktad£y. aykadspElafyuwwardz. 264 FIFTH GRADE lets see. Antidisestablishmentarianism. Ay en tee eye dee eye ess ee ess tee ay bee ell eye ess aitch em ee en tee tee ay ar eye ay en eye ess em. Do you know what that means. Its a doctrine pertaining to the Church of England. My my father told me what it meant. Starts with an em. What do you have something to do every day of the week. Well my weeks kind of foouh full. Every well usually Im working on some formula for the chemistry set. Oh my I have a telescope my mother she gets frightened to look at the moon. Shes sees the craters. And I was going to save up for a more expensive one but oh I was in a car accident recently. In fact Thursday thats why I wasnt in Hebrew. Yeah second one in five months. First one I got a hundred and fifty dollars insurance. Well why dont you talk then. Well I have quite a full week. Um Monday Wednesday Thursday I go to Hebrew school. On Friday um every other Friday I have a music lesson and everyday Ive got to practice violin and piano. Well Im not that busy any more. Go ahead Richard. Youre always talking so go ahead again. Now this is interesting. Lets see. Now dont start saying anything. I just I just finished my bonnet yesterday in um school. Did you finish your rifle. Were trying to make you not talk for awhile. I think so. Then how can you make me a you. I dont see how that can be done. I am not. Youve been reading books lately Richard. I dont know. He hes just making up things. I get confused which is which. Im lucky. I dont have any today. Do you have it Monday Wednesday Thursday. I have to go to the doctor today go to him from the accident. I he gave me some pills to take. I dont even take them. That youre supposed to um get better that way. Oh and all I have is a whiplash. Supposed to ease the pain and I dont have any right now. Well uh we stopped for some kids crossing on a crosswalk so a guy was speeding and feels like your heads snapping off. This is the second one in five months. The last time the guy hit us and then we went into a fire hydrant. Oh that reminds me. I have something to tell now. Um a few years ago on our street we live on Military and on Richland and Military on the corner theres a theres a hydrant. So there was a drunk man a few years ago it was right after my party. I was my father was helping me find room to put my toys. My new toys. So he he goes up on the curve and he knocks into the water hydrant and it starts pouring out. So everyone um all around our neighborhood comes up to see it and my father uh my father went out too. And there were I think it was fifteen police cars and three fire trucks. INFORMAL SPEECH 265 wElEtsiy. sntaydisastxbliJmantEriyanizm. EyEntiyyaydiyyayE? £s iy£stiy£ybiy£llay£s£yt£m?iy£ntiy tiy£yaray£y£nay£S£m. dyenowwe?6ae?miynz. sedaktranpartEyniq teftaCaCeviijIend. may mayfadertowmiywedi?m£nt. star?swi9en£m. wa? dyuwaev semOiotaduwEvriydEyaftawiyk. w£l maywiykskayndafuwa ful. cvri weyuwieliyamwerkinonsam formyelafe&akEmistriysEt. owmay ayavatElaskowp mayma&ar /iyg£?sfray?n taluka?&emuwn. JsiyzakrEydarz. na PaywazganesEyvepfara marikspEnsivwanba? owmPaywazinakaraeksadanPriysenPliy. mfaekderzdEy Aaetshwayazanninhiybruw. y£ sckantwaninfayvmants. farswanagodahendredenfiftiydalerzin/urans. w£l waydowntyuwtak&En. w£l Payhaev kwayde fulwiyk. em mendEywEnzdEyOerzdEyaygowdahiybruwskuwI. anfraydEy am EvriyefterfraydEyayaevemyuwziklEsen annEvriydEyavgotapraektisvaylinnpiyaenow. WE I aymnaP&aePbiziyEnimar. gowehEdriJard. yarowiyztokiq sowgowahEdagEn. naw &isiz?intar£stiq. ?£tsiy. nawdown?starts£yii]£ruy6iQ. ayjis ayjes firuJtmaybanaPyastidEy in?em skuwwel. didyuwfinijyarayfal. wirtraynem£ykyuwna?tDkferawayl. aGiqksow. &£nhawkanyum£ykmiyeyuw. aydown?siyaw&ae?kmbiydan. ayyaemnat. yuwvbinriydiQbukslEy?liyri£erd. aydanow. hiy hiyzJesmEykiQepfliQZ. ayg£?kunfyuwzdwi£iz wii. aymlakiy. aydow?hxv£niytad£y. dyuwhaev8?manzdEywEnzdEy0arzd£y. ayaeftagowda&adaktartadEy gowdamfamniyaeksadfn?. a ?iyg£ymiysampilzzat£yk. aydownniyventEykem. &ae? yarspowsa? am gE?b£dar&«?w£y. owen olayaevizewiplaej. powsta?iyzzap£yn aennaydow?haev£niyray?naw. w£l PawiystapfarsamkidzkrosinonekroswoksowagaywaspiydiQen fiylzlaykyerhEdsnaepiQof. &izizes£ken?werunfayvmans. elaestaym ftagay hi?as annEnwiywEnnintuwafayerhaydrant. ow&ae?riymaynzmiy. ayhaevsamOiqtatElnaw. am afyuwyiyrzagowonarstriy? wiylivanmilitEriy aenonriSlendemiluriy annakarnar&Erza ftErzahydren. sow ftErwazadrenkmsnefyuwyiyrzagow i?wazraydaeftarmaypardiy. aywes mayfa&erwazhElpiqmiyfaynd ruwmtaputmaytoyz. maynuwtoyz. sow hiy hiygowzeponekerv aenhiy naksinte&ewaterhaydrennaenniPstartsporiqawt. sowEvriywan am olrawndarnEyberhud kamzeptasiyit aemmayfa&ar a mayfa&arw£naw?tuw. aeP&awar ayOiqkiPwazfiftiynpaliyskarz aenOriyfayartraks. 266 FIFTH GRADE And um it took until about ten oclock to stop it because it was it was really running. Well Mariner two showed that the Venuses surface temperature was eight hundred degrees has a cloud layer forty starting forty five miles above the planets surface and there is on the surface and in a certain spot on the clouds probably a surface feature causing it theres a twenty degree drop in temperature. The clouds are about thirty degree below zero. Except for that. Do you know what the planets really are. Well no one knows their origin or anything but theyre all of them theyre mineral well just what is the earth. No thats not exactly what I mean. Well what do you mean. 11 dont know how to explain it better. So. Drop the subject. Oh yeah you know the principle the atomic bomb is. Um well its done theres several ways an atomic bomb is made. One when two you see theres a small amount of uranium in one part of the bomb yu two thirty five or plutonium otherwise and theres a larger one there and when they want the bomb they send a ray to go off they send a radio signal to it and they close and thats called a critical mass and then it just starts. Otherwise in a small amount you can shoot a neutron into it and that will start it or well yeah. A cyclotron is a device for shooting electrons well neutrons now because they used to be electrons but now we found that neutrons since theyre neutral um will not be repelled our um attracted by the atomic particles. And the sub I mean the subatomic particles. Do you have do you have any other favorite subject besides science. I like I like uh English. I like to write mystery stories. Ive written uh mystery stories and poems. I wrote a twelve page mystery story and it took me a half a year because I made a little outline and then I wrote a little. And I kept stopping and going. Why dont you write a book. There was a twelve year old girl took her two years she wrote a book and she died the day after it was done. She had tuberculosis or something. And they knew about it and she didnt it seem and it said in the paper that it seemed like she was hurrying to finish the book because she knew she was going to die. Well I sort of like spelling. That used to be mine. That used to be mine but I like English you know a little better. Because we have our background from our mother. Um shes a playreader. She does um Broadway plays that have about fifteen characters or so. She does it all by herself. She writes her own scripts too. Yeah um uh recently um my um um a friend of mine you know Mitchell Sperling. Yeah I thought so. He wants to make he told me he wants to make a glider that will carry a man. He wont be able to do it. He wants to make everything. I N F O R M A L SPEECH 267 x n am i?tukantilabaw?tmekla? tastapat bikazi?waz i?wazriliyraniQ. wEl m»ranartuwJowd&8t&aviynasazsarfestEmpaCaraz£ythandradagriyz xzaklawdlEyarfardiy? stardiqfardiyfayvmaylzabavdaplxnatssarfas aen ftarzasannasarfasxnd inasarPnspatannaklawdz prabkyasarfasfiyCakoziQi? &azatwEniydagriydrapintEmpa£ar. &aklawdzarabaw?9ardiydagriyz balowzirow s£pfar 6ae?. dayuwnowwa?6aplxnatsriyliyyar. w£l nowwannowzzErorJinarEniOiQbaP&Er oavam Aarminar wEjawadiz&iyyarO. now &x?snadigzxkliywadaymiyn. w£wadayamiyn. ay aydanowhawdagspl£ynitb£dar. sow. drapdasabjik. owy£ yanowSaprinsabal&iyatamikbarruz. am w£l ?itsdanaris s£vralw£yzanatamikbamizm£yd. wan w£n tuw asiy6Erzasmolamawntavyur£yniyumin wanpardadabam yuwtuwdartiyfayv arplowtowniyam adarwayzan6£rzalarj£rwan6£r?an wann£ywan?6abam&£ys£nnar£y? tagowwaf&EysEndarEydiyowsignaltuwat ann£yklowzannae?skoldakritakalmaes ann£ni?Jastarts. a&arwayzzinasmolamawn? yakanjyuwtanuwtron intuwit naedalstardi? or w£ly£a. asayklatran izadiyvays for JuwdiQalEktranz wElnuwtranznawbakaz 6£yyuwstabiyal£ktranzba?nawwiyfawn6a?nuwtranz sinsErnuwtral em wilnaPbiyriypEldaram trxktadbay ftiyatamikpartakalz. aen&asab ?aymiynnasabatamikpartakalz. dyuwxv dyaevEniya&arfEyvri sabjikbasaydsayans. aylayk aylayk ?a ?iqIiJ. aylayktarayts mistriystoriyz. ayvri?n amistriystoriyzaenpowamz. ayrowda tw£lvp£yJmistariystoriy xniPtukrruyahxfayiyr kazaym£ydalidalaw?layn annEnayrowdalidal. anaykEpstapiQangowiQ. waydownCaraydabuk. ftawazatwElvyiyrowldgarl tukartuwyiyrz Jirowdabuk s n JidaydftadEyysftariPwazdan. JiyhxPtabarkyalowsissarsamOiQ. s n &Eynuwabawdi?an/iydidan i?siym xnditsEdannapEypar&aPsiymdlayk JiywazhariQdafiniJabuk bikazjiynuwjiywazganaday. wElaysordalaykspEliq. ftsPyuwstabiymayn. ftstyuwstabiymaynbat PaylaykiQgliJ yanowalitalbEdar. biykazwiyhxvarbskgrawnframarma&ar. am JiyzaplEyrtydar. Jiydaz am bradwEyplEyz ftahsvbawPfiftiynksraktarzarsow. Jiydazi? u? bayharsElf. J lyraytsarownskripstu w. y£a?am a riysan?liyam may ?am ?am afrEndamayn yuwnow miCalsparliq. y£ay6o?tsow. hiywantsamEyk hiytowlmiyhiywantsamEykaglaydar&aPwilkEriyamxn. hiywown?biy£ybaldaduwat. hiywanstam£yk£vriy0iQ. 268 FIFTH GRADE First of all his design will never work. The wings werent curved. It was a well he had a biplane. And he had so many wires and strings going across it most of them without any purpose that it would there would be less drag if he just put a sheet of metal in front of it. And then he had no no lets see no aileron. How big was how big about was it. Hed want he had a wing span of nine feet. Uh first of all where would he keep it. Second of all that thing he designed wouldnt fly. Oh he did make though with Ricky Rodriquez and Norman a kite about its six feet high and three f~ I mean five four or five feet wide I dont know exactly. And they flew it and took three guys to hold it. They made it them themselves. I made a three foot one a long time ago. There you had to have a strong wind to get it up. A few weeks ago they had a kite contest who could fly it the furthest. The one in Mar Vista it was in the paper that it showed a kid trying uh practicing in Mar Vista. Well Im not sure where it was held someplace around Mar Vista park. Well maybe the world will come to an end and everything will happen. We had a friend over because her mother was in an accident and she was in the hospital. So um her daughter stayed over at our house. And she slept with us and everything. And she noticed a habit of our baby sister. I like most of the kids in school but some kids. Yeah like Dera. She does everything different than everybody else. She reads books all the time. Yeah she never listens to the teacher. Her hair is so long. Yeah shes unusual. Right now shes a nut. Typical nut. She um her mother put her initials um out of a famous person you know she was named her initials were named for her. I forget what it I think they were last she was a lady and her last name was Harrison. Well that thats one of them he has and then he has a one in uh uh well it its its its its where you could ride horses or its um its up in the hills. Well my father he owns a shop. And uh this um this wrestler goes in there when hes not supposed to hes not allowed to go in and we saw him on the night he didnt know he he was a wrestler. We saw him on the on the night the other day. And we found out that um hes not allowed to be there. I dont know. Hes not allowed to buy stuff. Why isnt he. He gives me a good deal. I get everything half price. And I get some things free. Like caps and stuff. But he gets mad after I take too many. When I take about oh about two three boxes. And and yesterday I bought this little plane and I put it together and it was just a fifteen cent INFORMAL SPEECH 268 farsdavslizdiyzaynwilnEvarwark. &awiQzwarn?karvd. Piwaza wtl hiyaedabayplEyn. niyaedsowmEmywayarzanstriqzgowanakresit mowstavamwiOawdCniyparpas 6 « ? i?wud ftarwudbiylEsdraegifiyJaspadaJiydamEtalinfrandavat. aenncn hiyhaednow now Icnsi now wEyliyaran. hawbigwa? hawbigabaw?wazat. hiydwan? hiyaedawiqspaenavnaynfiyt. a fersovolwerwediykiypit. sckandevol 6«?0iqhiydazayndwudanflay. ow hiydidmcyk 6ow wi&rikiyradriygasannorman akayt abaw? i?siksfiyt hay nOriyfaymiynfayf forarfayfiy?wayd aanowgzaekliy. aennEyfluwat antukOriygayztehowldat. fteymcyftatcm AEmsElvz. aymcydaOriyfutwanabqtaymagow. &£r yahaedaaevastreqwindagEdidap. afyuwwiyksagow&EyhaedakaytkontEst huwkadftaya?&afar6as. ftawananmarvista i?wezin&epEypar&a?itJowdekittr£yn ?apraektasiqinmarvista. wtl aymnaPjurwEriPwazhEldsamplEysarawmmarvistapark. wElmaybiy&awarldalkamtuwannEndanEviyOiQalhaepan. wiyaedafrEndowvarkazzermadarwazinanaeksidEnPEn/iywazin&ahaspidal. sow ?am hardadarstEydowvaradarhaws. aen JiyslEpwiOasannEvriyOiq. aen? JiynowdtsdahaebadavarbEybiysistar. ataykmows a&akidzinskuwl batsamkidz. ycalayk daera. JiydazEviyOiq difan?6en EvnybadiyEls. Jiyriydzbuksolataym. y£ JiynEvarksanzta&atiyfiar. harhEyrsowbq. y£ Jiyzenyuwiuwel. ray?naw Jiyza nat. tipikal nat. Jiy am harma&arputarn aemjalz am awdave fEymasparsan yanow JiywaznEym harni/alzwarnEymfarar. ayfergi?wadi? ayOiq? 6Eywar laes JiyazalEydiy aennarlaesnEymwaz haerasan. wElae? &ae?swanavamhtyaez annEniyaeza wanin a a wai? i?si?si?sw£ryakadraydh3rsiz ants am ?supinnahilz. wal mayfa&ar hiyownzajap. aen a 6is am srEslar gowzinnEr w£niyzna?sapowztuw hiyznadalaw tagowin aenwiyso imonnanayt hiydinnowiy lywazarsslar. wiysoiman&iy on&anay? &iya&ard£y. awiyfawndaw?6ae? am znadalawtabiy&Er. ayownnow. znadalawtabaystaf. hwayizanmy. hiy givzmiya gu?diyl. laygEdEvriy&iq haefprays. annayg£?sam&iqzfriy. laykaeps nstaf. biyg£?smaedaefdarayt£yktuwm£nty. w£nnayt£yk?baw? ow baw tuw Oriybaksaz. aend aenyfstardfy aybaP&islidalplEyn aennaypu?tag£bar aenni?waz|asta? 270 FIFTH GRADE plane about that big. And you and its a wind up plane you know where you wind up the rubber band. And when I wind it up it went went about a hundred feet up way up it just it was like a plane but it kind of goes like this and then it starts going straight up and then it curves over here. I almost lost it when it curved over. Well see it was theres a roof right here like this theres a roof and then the plane was starting to come over. And I and I thought it would start going down and theres a you know a little part right here you know a house the you ever seen a house that was like this. And then there was a flat top roof right here. Yeah that its kind of like ours. And you go up and then it went down I thought it was on this part of the roof but it went over. It was just right on the ground. Yeah. I thought it was on the roof. Probably couldve climbed up up on top of the roof. My friend is is his house is real easy to climb on top. Climb on top of it all lots of times. I fly his planes off of it too. One thing sometimes our uh teacher Miss Schwartz she comes sometimes uh does things like well when were doing something she just blames it on us. Were not even doing it. Yeah. And some and on sometimes usually Im always good in the room its always been mostly Susie is too. Mostly a lot people is but it is always just a couple of people. They always hold back the whole group. Yeah like today. Sometimes its different people though. Well like a couple people are talking. And fooling around she blames the whole class. And then she talks to those guys well she sees them then she talks to those guys and then a lot of other guys start talking starts getting into a riot. Yeah. We were having softball today for pee ee you know. We dont have pee ee in the afternoon we have ten after eleven. We have it at one thirty. So we so we were going to have softball and most guys they dont ever get they get out there about three times out of the week. Yeah we barely ever get out on the and play. And when we do we probably get about ten minutes. Some well were lucky we get twenty. And we were going to play softball today I mean she gives the girls a real good area and then she gives the boys a real lousy one. Or just the opposite. And we were going to play softball today I mean um Friday we were supposed to play softball and and we were noisy so we couldnt. So Monday the girls the girls got to because no uh Thursday you were the girls were couldnt play softball because they were fooling around. And so one day they got to because they didnt get to uh Thursday. And then uh today we cant play softball. But and then we asked her could we play it tomorrow because the girls got to the day they werent paying attention. She says no. INFORMAL SPEECH 271 fi?tiyns£n?pl£yn abaw?6ae?big. anyuw anni?sewaynda?plEyn yanowwEryawaynap&araarbaend. snw£nnaywayndi?api?w£n wEnabawdahanardfiydap wtye ¿ i s i?waz laykepl£ynbe?i? kaynagowz layk&is en£nistar?sgowwii]str£ydep ancni?karvzowvarhiyar. ayomowsslosti? w£ni?kervdowver. wulsiyawus ftErzaruf ray?hiyr lay?&is Aazaruf en&cn&aplcynwazstartntakamowvar. na nay93?i?a?star?gowWindawn anfrza yanow alidelpar?raytiyr yuwnowahaws 6a yfvarsiynahaws&awazlayk&is. aendEn &araza flae?tapruwfraytiyr. yE&ae? skaynalaykarz. anyagowwap anriEn t?w£ndawn ?ay03?i?w8Z3nnispar?8&aruwf badi?w£nowvar. wazjisraydsnnagrawn. yea. ay63?i?waz3nnaruwf. prabliykudavklaymda? epontapederuf. mayfrEndiz izhizhawsizriliyziytaklaymentap. klaymantapavids? lasataymz. ayflayizpl£ynzofavi?tuw. wanOiq samtaymzar a tiyCer mis sawsrC Jiykamzsamtaymz a daPOiqz layk w£l wEnwirduwiQsamOiq/iy JasblEymzidanas. wirnadiyvan duwiQQi?. y£a. ansam inon samtaymz yuwiuallaymowizgudinnarum tsoizban mowsliysuwziyiz tuw. mowslty ala? piyballiz badidi?s3wiyzjisdakaplapiypal. &Eyh3wiyzhowbsk6ahowgruwp. y£ layktadEy. sammaymziPsdifarnpiypalftow. weI lay akablpiyblartsakan. anfuwliqqarawn Jiy blEymzehowlklaes. annEnJiy tokz ta&owzgayz wEjiysiyzam&an/a toks te&owz gayz enn£nalad8adargayzstar?toakin starPsgEdiQqintuwaraya?. y£. wiywerhaevinsofboltadEy farpiyiyyanow. wiydown?haevpiyiymniyaeftarnuwn wiyaev tEnaefterelEven. wiyhaevat ae?wan8ardiy. sowwiy sowwiyargenhaevsofbol amowsgayz &£ydow?Evargi? &agidaw?&Erbaw? Oriytaymzawdavawiyk. y£ wiybErliyEvarg£daw?nna nplEy. anwEnwiyduw wiyprabliygidabaw?t£mmtna?s. sam hwEwiyrlekiy wiyg£?tw£niy. ?8wiywerganapl£ysafboltsd£y aymyn Jigivs&agarlzariylgudEriya annEn/iygivzebsyzariyllawziywan. arJasOapazi?. ?awiywarganaplEysafb3ltedEy aymiyn ?am fraydEy wiywarspowsaplEy sofbol an aenwiywarns yziy sowwiyku?n. sowmandEy &agarlz 6egerlzga?tuw bikaz now a SarzdEy lywar dagarlzwar kuPnplEyssfbslbikazzEywarfuwIiQqarawnd. ansow wand£y&£yga?tuwbikazz£yding£?tuw a OerzdEy. an&En a tadEy wakaen?pl£ysofbol. ba? aennfn wiyyaestar ku?wiypl£ya?tamarow bikazzaagarilzgaPtuw &ad£y &£ywarn?p£yyinat£njan. JiysEznow. 272 FIFTH GRADE Yeah she always says that. Well I was just saying that she always says that when we do the those things. David always takes my girl scout hat away from me. Yeah and he was throwing it at me and I thought she was doing it. And and usually uh usually we play softball once we played two kickball areas that was good. We like softball the best though. Thats one of our the boys like it the best I know that. And we we played dodge ball today. Yeah guy we were the only the all the other people in the it was so hot that all the other people were just sitting there. We and Tim were the only ones playing. Against five guys. After after I had to wash my face I was so hot. Because see my face was so red. It was dirty too. Yeah. Then he throws it at Norman. Today we played uh a game called spello. You know its just like bingo but its with words. Theres five here five this going this way theres about four or five this. No. Five for the every way except it look it looks like this but therere still five. It looks like there but just so the way she has it. Its a its just this the way she has it its like oh like that. Just seemed like theres five across. Yeah well you got the word every time. It was just that it was in different places. Usually after school I play with my friends. But usually if I have a lot of homework usually just do it right after school. Today I just I I finished I did all the syllables. We had a report we have to have a everyone has a report on a state and we have to get it in by May six. Yeah four days before my birthday. Mine was Washington. Well you could really write anything about about you had to have cer- well certain things on the paper but you could add extra if you wanted. Like history. We dont have to do that even though its on there. And I did California but then then she changed it and so everybody have to have a different one. I practically finished it in one night. You had to do another one. Yeah. It has a whole bunch it has about ten pages on Washington its about you know there the world book about that big and then and it has on the on the on dublyu wy and dublyu ex wy and zee theres one book because theres you know you cant get very much in that and about say about a tenth of the book is Washington. Washington dee cee and Washington everything about Washington. Takes at least a week. If I- dont get mine back by twenty first of May then Im going to April then Im going to uh um go to the library. Lets talk about Dera. INFORMAL SPEECH 273 yajiyswiyzfzzae?. w£awai£s£yinna? Ji?3wiys£zzae?wEnwiyduwi&a&owz6iQz. dEyvadswiyzUyksmaygerlskawthaedewEyfremnu. y£enniywez6owiQQi?ae?miy aennayOaCiywezduwiQit. ?en ?anyuw2aliy e yuwieliywiyplcy sofbol wanswiyplEyd tuwkikbslEriyaz &»?wazgud. wiylayksofbolftabEsbow. &ae?swenavar &ab3yzlayki?&ab£sdaynow&a?. aewe wiyplEydaJbsltadEy. yE ga wiywar&aowuwn 6a o&e?e6erpiypel inna t?wa?sowha?dad3l&iya&arpiypal warJassidiq&Er. wiyentimar&iyownliywanzplEyin. agEns fayvgayz. aeftar aefterayhxdawafmayfcys awazsowhat. bikazsiy mayfEyswazsow red. ?sdertiytuw. yea. bCnniyOrowzidaePnsrman. dEywiyplEyd a agEymkslspElow. yuwnow ?iJaslaykbiqgowba? itswiOwardz. ftarzfayvhiyr fayvbis gowwan&iswEy dazabawPfsrarfayvbis. now. fayfar&a ?£vriyw£y £ks£pi?lu? i?luksayk6is ba?&£rstilfayv. i?lukslay?&£rbat las sow ftawfy/iyhaezat. 6itsaatsjassis &aw£y/iyhaezi?itslayk ow laykftaee?. JissiymlayP&erzfayvekros. y£a w£l yuwga?baward Evnytaym i?wa2isdae?i?wazindifran plEysis. yuw2aliyaeftarskuwlaypl£yi0mayfr£nz. be?yuw2liy fayavala?ah3mwark yuwiliy Jasduwa?raydaeftarskuwl. tadEyaydis ayay finijt aydi?3llasilebalz. wiyaedanypar? wiyaeftahxva EvnywenhaezariypsrdsnastEy? n wiysftagEdidmbaymEysiks. y£a fardEyzbiformabarOdEy. maynwazwsjiqtin. w£al yuwkadriliyray?£niyOiqqabaw? baw? yahae?tehaev walsar?n0iqz3nap£ypar ba?yuwkadaed£kstre fyuwanid. layk histany. wiydown? haefteduw&aet iyvan6owi?s3nn£r. naydi? kaekfornyaba? 6an banJiyCiynJdi? nsowEvriybadiy haef tahaeve difran?wan. ay praektikliy finijdi?nwannayt. yaaetaduwana&arwan. y£a. tthszahowlbanC ithaezabaw? tinp£yjtz3nw3jiijden tsabaw? yanowuw &£r ftewarlbuk zabaw?&ae?big an£ eni?haez ana sna sn dabayuw way an dabayuw Eks wayan ziy &£rzwanbuk kazzErz yuwnow yuwkaen?g£?v£riymaC innae? anabaw?? sEyabaw? aUnOa&abukizws/iqtan. wsJiQtandiysiy anws/iqdan EviyOiqqabaw? wojiQtan. t£ykza?liysdawiyk. ifaydown?g£?maynb«kbay twEniy farsdavmEy &Ennaymgena Eypral &Ennaymgana a am gowdelayb£ny. l£?st3kabaw?diyra. 274 FIFTH GRADE Yeah. Well. She got long hair. No uh no. Ill tell you something. No well some kids in our class that we was all messed up and and you know we did their our work. Like um last year when I was in this room I used to sit next to this boy and he always used to bother me and he never used to get. Who. Jeff Case. He never used to do his work or anything. He always just wrote his paper and did nothing and so he got into a higher room and he didnt he he got into that ae five bee six and some people just dont know how he got into there. A boy I was talking about well he uh draws pictures at arithmetic he gets ten words because he cant do any more. Hes always going around beating everybody up. Some kids dont know how to do things like um theyll listen to the teacher but they just dont understand and so they need help by some kids and. Yeah like. Like this morning remember I was helping Lorrie with her bonnet I was showing her what to do. Yeah our student teacher shes just so grouchy. Oh. Yeah we got the grouchiest teacher. Oh. Yeah she she she um she sees um you know other persons talking right next to you. Um well if there was somebody sitting next to you and he was talking she would blame it on you. She would say stop talking you know and everybody um says he was talking and you know. Oh and in in football some kids even the girls they boss around when theyre not even the team captain say you get over there or youre not going to have your ups because youre a this you know even if you are on this team you got to work for your ups so I go another team you say you cant play on this team so I go up to the other team. You get all messed up. Yeah and guy they laugh at you when you miss the ball. Some and you and so when uh when someone misses the ball and theyre not very good at it so the other girls who think theyre real good they start screaming at them but when those girls miss the ball oy nobody screams at them. And if someone does they get him. And some girls in our room just show off too much. Yeah everybody says shut up. It seems like all the girls theyre sort of. Seems like all the boys are sort of. Dera shes a queer. Guy. Go ahead Allison. Okay. Know whenever she reads a book um during discussion anytime the teacher never says anything to her she uh lets her read and then when somebody else starts reading the same time Deras reading now you put that book away or 111 send you to the office. And our teacher our afternoon INFORMAL SPEECH 275 yte. wEyal. JigaPloi) htyr. now e now. aatEyuwsam&iQ. no we I samkidzinarklaes 6ae? wiyez olmesdap an anyaowwiydid&Erowark. lay? am laesCiyr hwEnaywazinnisruwm ayyuwstasiPnEksta&isboy anniyowiyzyuwstabaftarmiy. ncvaryuwstagct. huw. jEf keys hiynEvaryuwstaduwizwar kar£niy8iq. hiyowiyzJasdrowdizpEypar aendidna&iq ansowhiyga?nda ?a hayar ruwm amydi? hiy hiy gaPmta&ae? Eyfayvbiysiks an sampiypal JasdownPnowhawiygaPinta&Er. aboyaywaztokinabawPwa hiy a drozpiCarzaedariGmetik hiygiPs tinwarPz biykaziykaen? duwtniymor. hiyzowiyzgowiQarawn biydiQQEvriybadiya. samkidsdownPnowhawdaduwOiQz layk am &Eyllisanda&8Uy6ar baP&EyJssdown? Pandarstaen ansow&EyniydhElpaysam kidz an. yc layk. layk&ismarnii] nymEmbaraywazhElpiQ lariy wi9 harbana? aywaz/owwiqarwataduw. yE arstuw?ntiy£ar Jiyzassowgraw6iy. ow. y£wiyga?&agraw£iyas tiyCer. ow. y£a Jiy Jiy Jiyam Jiysiyzam anow aftarpersenztakiQrayPnckstuwyuw. em w d if&Erssambadiy sitiqnekstuyuw enhiyweztoktrj JiywoPblEymtdonyuw. Jiyud s£y staptokiQ yunow an Evriybadiy am s£z hiywaztakiqanyuwnow. ow aend in infuPbol samkidz ivanagarlz zEyboserawnwEnnErnadiyvannatiymkaePmmsEy yuwgEdowver&Erar yanaPgenahaevyaraps kazyara &is yanow ivanifyuwarannistiym yuwgadawarkfayarups sowwaygowene&artiymuwsEy yuwkaemplEyandistiym sowaygowuptuwaPe&artiym. yeg£??olmtssd ap. yEaaen gay&Ey laefaePyuw wEnyuwmisPdabol. sam aenyE aensowwaena wEnsamwanmisazzabo aend &ErnaPv£nygudaedi? sow&aPa&argarlz huw&iQ&Erriylgud &£ystarPskriymiqae?&£m baPwEn&owzgarlzmiszabal ay nowbediy skriymz aeP&em. annifsamwandaz &£yg£dam. aensamgErlzinarrum JesJowwof tuwmat. yEEvriybadiysfz Jadap. iPsiymzlaykol&agarlz ftarsarda. siymzlayk al fteboyzersorde. d£ra Jiyza kwiyr. gaP. gowahEdaelisan. k£. naw hwEnEvar/iynydzabuk am duriQ diska/an aeniytaym &8tiy£arnEvarsEzzEniy6iqtuar JiPa lEPsarriyd an&EnwEnsambediyEls starPs riydiq &a sEymtaymdiaznyiQ naw yuwpuP&aePbukawEy araylsEnyuwtuw&iyofas. aennar tiy£ar ar 278 FIFTH GRADE teacher. This is her. She is such a grouch like um like Carols try uh showing me how to do this hard problem and so the teacher says now you two be quiet or 111 send. And then once this other teacher who comes once a week you know that well um our class the high group we were getting all messed up because we didnt like the teacher and so we we we made up a time you know and everybody looked at the clock at twenty five after everyone had to start coughing. On purpose. And so that day were were always real noisy you know and and every day and so sometimes we start coughing and then we drop um one time all of us drop our pencils at one time and we bang it and everything and we shut our books real tight and so um so this teacher who comes once a week she was um leaning over to this other boy she wasnt helping him or anything. And on that day our afternoon teacher she got real mad at us and so she gave us work and we werent supposed to have work on that day. She was supposed to just teach us on that day you know. So um she gives us a whole bunch of pages. This teacher comes one one day she leans over to this boy and this afternoon teacher comes over this uh this afternoon teacher comes over to the other teacher and she says um Teddy can do it himself. She even tells the the the other teachers what to do. Yeah shes so bossy. And so this teacher shows off when when um when Miss Goldstein comes in because she shows the teacher that she can control us and she really cant. Yeah because shes such a show off. Because you know whenever another teacher comes in. Yeah she she stands up there and and um just stands there waiting for everybody to be quiet. She doesnt do anything. And she um when she asks somebody to do something um you know she just calls them up then she starts walking all over the place and they follow her and and theyre wondering what she wants. And so they follow her all around then for about fifteen minutes she tells them um yeah um you know you do that and you do that. She always goes to the chalk thing you know where you lay it the chalk and she always picks up a chalk piece of chalk and she always goes like this while she walks along. We call her something our class calls her something but we cant tell you. Her name is Marilyn Schwartz. Her Marilyn her name is Marilyn um Schwartz and we call her Marilyn Swivel Hips. You know that big ape Clover goes up to the teacher she was on yard duty and so she said she said hello Marilyn Swivel Hips. And so and so Miss Schwartz says um she says Clover. Oh yes. And today in arithmetic she was she you know those uh problems, you go like two times two take away two and divide and things like that. So um she had a card INFORMAL SPEECH 277 aefternuwntiyter. ftisizher. /iyizse£egraw£ layk em lay?kaerelz tra?a JowiijmiyhawtaduwisharPprablem aensowetiy6erse nawyuwtuwbiykwayad orayl sent. ennenwens&is e6ertiyCeruwkemzwensawiyk yanow 6i? WE I am arklaes 6ehaygruwp wiywergEdiq3lm£sde?bikazwiydinlay?detiy£er ensowiy wiy wiymEydepetaym yanow aen Eviybediyluke&eklakae?twEniyfayvaefter £vriywenhae?testartkofir). onparpes. aensow 6ae?d£y wiyar wiyerowiyzriylnoyziyyenowen aennEviydEy aensow semtaymzwiystar?kofiq annenwiydrap am wentaym3lavesdraparp£nselze?wentaymmenwiy?baei]i)e anncva&iq nwiy /edarbukzriyltayt aensow emsow&istiy£er huwkamzwansawiyk Jiywez em liyniqowverte&ise6erb3y Jiywezent hclpiqemerEniyOtQ. aennannae?d£y ar aeftenuwn tiyCer /iyga?riylmaededes ansowjigcyvaswerk enwiywernspowstehaevwerk3n&ae?d£y. JiywezsepowzteJastiyieson nae?d£y yena. sowem Jiygivzese howlben£epEy]ez. 6istiy£erkemzwen wendcy Jiyliynzowvertefttsboy aen&is aeftenuwntiy£er kemzowver &ts ?e ftisaefdernuwn tiyCer kemzowvertuw&eedertiyfier enscz em tEdiykenduwidimsElf. /iyventElz&e &i &e&ertiy£erzweteduw. yE/iysow bosiy. ensow&istiyCer/owzofhwEn wenem wen misgowlstiynkemzin biykez/iy/owz6etiy&er&0?/iykenkentrowles enjiyriliykaen?. yce ekezJiyseCe/owof. bikezyenow hwEnEverene&ertiyCekemzin. yea Jiy JiystaenzepftEren en em Jesstaenzzer wcydiq JfsrEvriybediydebiykwayet. Jiydezen?duweniyOiq. aenjiy am wcn/iyaessembediydeduwsemOiq em yenow /lyjeskolzemap &En/iystar?sw3kinolower&epl£ys en&Eyfaloweren enntr wendnqwa?Jiywan?s. ensowbiyfalowerolerawn &En forebaw?fiftiynmina?sJiytElzem em yEe em yuwnow yuwduw&ae?n yuwduw&ae?. Jswiyzgowzte&efiak&iq yenow wEryal£yi?6a£ak enJiowiyzpiksepeCak piysetak an/i3wiyzgowzlay?&is way/iywokselsQ. wiykolersemftiq arklaeskolzersemftir) be?wiykaen?t£lyuw. herneym iz meralin /worts. hermErelenhernEymizmaerelin em /worts enwiykolermaerelenswivelhips. yenow6ae?big£yp klowver gowzepte&etiyCer /iywezonyar?duwdiy ensow/isf? /is£? helowmEnlinswivelhips. aensow aensow misJwor?sEzem /ISEZ kleowveer. owyEO. aentedEy EneriOmetik Jiywez /iy yenowftowz e prablemz yagowlayk tuwtaymztuw tcykewEytuw aendevayde n0iqzlay?6ae?. sowem /tyaedekard 278 FIFTH GRADE with some on and this boy was sitting next to me and he saw them and he said oh boy. He says oh boy some of those problems and so she says well it looks like you dont want to do it and so she goes and puts it in his book in her book you know. And she says then she say? to the group she says I was going to give you some of those real fun problems but Ricky was talking for his group. He all he said was oh boy. Yeah and also shes so absent minded you know. So um I start my spelling because my girlfriend let me copy down the you know the words from her list. And so shes still jabbering away as usual and the class is screaming. She doesnt give a darn. At least shes better than that one we had in Miss Lanneys room. Miss Landenhine. She was a witch. Oh I hate her. She makes us put our heads down every afternoon. She says were tired. She wouldnt even let us read our book. Yeah and one time she pulled up she put um Saris head down and then she pulled it back up by her hair. No that was Debby Kelley. She makes us write this this note you know. When someones bad when someones bad. So one time this this girl by the name of Debby Kelley she writes it and so she and so she had to put she had to put Dear Dear Missus Lindenhine and so she didnt know how to spell Lindenhine and so she spelled Lindenhine wrong and so the teacher made it write it write it all over again. And you know what this kid did she threw it up she tore it up right there and threw it in the trash waste paper basket and she didnt care. And all the kids we gathered up and we after school Debby was the leader and we we all went to the principals office because she wasnt being fair to us at all. And so you know this teacher knew because she knew everybody hated her and so um one day I was in the room during lunch and she comes up to me and says Sari how come all the kids hate me and and so I I didnt want to tell her but I couldnt just say I dont know you know because I was in it and so I said well for instance like we dont like to put our heads down at lunch time and so then another teacher comes along and starts talking to her so I get away. One time she uh everybody went to the office after school and she asked me uh what was happening. And I said oh I dont know. So um I think you came up no wait yeah it was you you told her. No I didnt. And also um usually all the afternoon teachers show off. And guy Missus Lindenhine she looking exactly like a witch. Black hair always in the same hairdo. And guy she put uh about Id say about a whole pack of make up on guy uh uh face was white and then a little dab of red you know and uh fire engine red lipstick oh and eye mascara eye shadow. And she put her hair up like this and she was real mean. INFORMAL SPEECH 279 wiOsamon enisboy wasitiQnEkstamiy anhiysa&amniysE? owboyiy hiyOEz owboy GamaOowO p r a b l a m z a n s o w JiysE wEliPlukzlaykyuwdownPwanaduwa? ansowJiygowzanpu?si?nizbuk inharbuPyanow. an/iysEz n£njiys£zta&agruwp JiysEz aywazganagivyasama&owz nylfanprablamsba? nkiywaztakiQfarizgruwp. hiy oliysEPwaz owboy. yta aenalsow Jiyz sowaebsanPmaynda yanow. sow am aystarPmayspElif] kaz maygarlfren lEPmiy ¿ a p i y d a w n n a yaow dawarPzfamharlis. aensow JiystilJaebriQawEy azyuwiuel an aklxsizskriymir). Jiydazangivadarn. aliysfiyzbEdar ftannaePwanwiyhaedimmislaeniyz rum. mislaendanhayn. Jiywazawi6. ow ayheyt har. JiymEyksaspudarhEPzdawn Evnyaeftanuwn. JiysEzwir tayard. JiywuPnivanlEdas riydarbuk. y£ aen w a n t a y m j i y p a l d a p Jiypu? am sanyzh£?dawn en£njiypuldi?baeke?bayherh£yr. now&aePwazdEbiykEliy. JiymEykzasrayP&is &is nowPfianow. wEnsamwanzbaed hwEnsamwanzbaed. sowwdntaym&is &isgerlbayftan£ymavdEbiyk£liy Jiy rayPsi? nsow Jiy ansowJiyhaePtapa? JiyhaePtapa? dtyr diyrmisazlaendanhayn a n s o w JiydinnowhawdaspElEndanhayn a n s o w JiyspEldlaendanhaynroi) ansow&atiy£arm£ydi?raydi raydi?olowvereg£n. anyanowwaP&iskiddid Jiydruwidap Jiytoridapraeern 8ruwa?natre? wEyspEyparbaeskaP n/iydinker. aen ol&akiPz wiygae&ardap anwiy aeftarskuwwai dEbiywazzaliydar aenwa? wiyolwEnta&a prinzabalzofis ka? JiywazanPbiyiqfEyrtaasadal. aensowyanow ftistiyCernuwkaz JiynuwEvriybadiyhEytadhar a n s o w a m wandEyaywazinnarumduriQlanC anjiykamzaptamiynjaz sEriy hawkamol&akiPzhEyiPmiy aen aen soway aydinwanatElar b?ay kuPnJassEy aydannow y a n o w bakazaywazini? a n s o w a y s f ? wul farinstansayk wiydanlayktapudarhEPzdawn a?lan£taym ansow&anana&artiy^arkamzabQ anstarPstokiQtuwwar sowaygEdawEy. wentaymjiya EvibadiywEnPtaftaofis aeftarskuwl njiyaesmiy a hwawazhaepniq. naysE? aow ayownow. s o w a m ayOiqkyuwkEymap nowwE? yEiPwazyuw yuwtowldar. nowwaydiPnt. analsow am yuwialiy olliyaefternuwn tiy£arz Jowof. aengaPmisazlEnahayn/iyluk an £gzaeklilaekawa£. blaekhEyr owiyz innas£ymh£yrduw. aengaP JiypuPa a b a w aydsEyebaw a howpaekav mEykapan gaya a f£ys wazway? annEna lul daebavrEd y a n o w aen ah fayarEnJanrEdlipstik ow aenaymaeskaera ay /aeow. sn/iypadarhEyraplayk&is nJiyazriylmiyn. 280 FIFTH GRADE Yeah she had some uh fake hair you know that kind. Oh she was so mean. You know what happened once. This boy who sat next to me he likes to draw you know and so he didnt have his notebook with him and so he asked me for a piece of paper and a Marks-a-lot that I had so I gave him a piece of paper and a Marks-a-lot and so the teacher comes along she says Steven I thought I told you not to do that anymore. And so she takes the paper she tears it up throws it in the waste paper basket and then takes the Marks-a-lot and puts it by the teachers desk you know so the teacher could take it by accident and I ask her if I could have it back to my desk because it was mine. She says no no no and uh and um these two girls were in our room and they always take things that they see lying around anybody could have taken it. Its expensive and so um at two oclock recess you know I went down and then when the bell rang I just stood by the room and I wouldnt go in and the teacher found out and she sent some kids out and she says tell Sari to come in and I wouldnt go in. So she comes out and she says if you dont come in here Im going to get you. I get the Marks-a-lot you know and then she takes it away from me and then I get it again. Oh I hate her. Oo. I got over a thousand of them. I know a friend of mine hes got a um hes got a whole box of bottle caps. About two boxes of bottle caps. With the pictures in them. Oh. Those things. I only got around five of them. I only have four. Well on Saturday I usually go to my friends Mitchells Jeff McCraesor. Yeah. I knew him for over two or three years you know. And we go around and once we went to Santa Monica Airport. And we played arourid there and we went to a plane you know. And and you know they told us that we could go. And they gave us some potato chips. What kind of pets do you have. Huh. Pets. Pets. I dont have any pets. I used to have. You got a dog. And a cat. And I used to have fish. And I used to have a turtle. And lets see I used to have a bird. I used to have a dog. I used to have Ive got a dog now I used to have two parrots I used to have a raccoon I used to have a oppossum and I used to have a gopher snake. I used to have I used to have a snake. About this big you know. We caught it and but then it went away. And then we had and then I had three turtles and they all died. And then I had a dog. My grandfather owns a place up in the desert and we we found a lizard INFORMAL SPEECH 281 yc Jiyhaedsem efcykhcyr yenow &ae?kaynd. ow Jiy wezsowmiyn. yuwnowwadhaepanwans. &isboyhuwsae?n£kstamiy hiylaykztadro yuwnow aensow hiydinhaeviznow?bukwi8am ansowiyaesmiyfarapiysapfypar aenamarksala?&adayae? sowaygfyvimapiysapfypar anamarksoa? ansowftatiyCarkamzelaq Jiaz stiyvan ay6odaytowJuwna?teduw&aed£niymDr. ansafitcysapcypar Jiytcrzadap 8rowzi?naw£ysp£yparbaeska?n£n Uyksamarksala? anpu?si?bay &atiy£arz desk yenow sow&atiy£arka?t£yki?bayaeksid£n? aennay aeskarfayka?haevi?baek tamaydes kazi?waz mayn Jisiz nownownow aen a? aen am &iyztuwgarlzwerinarrum aen&£yowiyzt£y?8iQz6a&£ysiy layiq arawn £niybadiykedevt£ykam?. spcnsivansow am ae?tuwklaknys£syanow aywcnPdawn aennfn hw£nnab£lraeq ayjasstu?bay&arum aenaywudengowi?n aend&atiyCar fawndua? aenjiys£n?samki?zaw?njisaz tflsiyriydakamin aenaywudangowin. sowJikamzaw?nJis£z fyuwdown?kaminhiyraymgenag£dCuw. ayg£?6a marksela?fienowennen/iyt£yksidew£yfremiy annanayg£di?ag£n. ow ayh£ythar. uw. aygatowvara8awzandav?am. aynowefrfndamaynhiyzgate? am hiyzgatahowlbaksavbadalkaeps. abawTtuwbaksazavbadalkaeps. wiftapik/arzinam. ow AowzOigz. ayownliyga?arawnfayvavam. ayowniyhaefowr. w£w onsaetardfyayuzaliygowtemay frEnmiCalz Jaf maekrtyz or. y£a. aynuwimfarowvartuwarOriyyarzyanow. aenwiygowarawn anwanswiyw£n?tasaenamanaka£rport. aenwiy plEydarawn&Er onwiyw£n?tuw aplEynyanow. ?aen ?aen yanow&Eytowldas&ae?wiykadgow. aen &£yg£yvassampad£ydow6tps. wa?kaynap£?tsdyahaev. hah. p£tS. p£ts. aydownhaevfniypEts. ayyuwzdahaev. yuwgatadag. anakaet. aenayyuwzdahaefij. aenayyuwzdahaevatardal. aenlftssiyayyuwzdahaev abard. ayyuwztahaevadag. ayyuwztahaev ayvgatadagnaw ayyuwztahaevtuwperats ayyuwztahaevaraekuwn ayyuwztahaevaposam aenayyuwztahaevagowfarsneyk. ayyuwztahaev ayyuwztahaevasncyk. ?baw?&isbig yanow. wiykodit aen ba?6cni?w£naw£y. aen&£nwiy?haed aen&Enayhaed Grtardalz aen&Eyoldayd. aen&snayhaedadag. maygraen?fa&arownzapl£yapin&ad£zar?anwiy wiyfawnalizar 282 FIFTH GRADE and the next time we came back we tied him up and the next time we came back he left his tail. He was gone too. Where I used to live up in Benedict Canyop we had a um bunch of horses. Did you see that movie um The Castaways. Oh I oh I I saw some of it. That was tough. They were um going on this boulder man. First of all there was these natives they got caught by in New Zealand. So then um when they got caught by the natives they they locked them in this this house out on a um round cliff thing with a thing going a bridge kind of. And then then about two hundred feet down. So then they he the guys had made um there have got other captives in there they made a big long rope with their hairs you know. So then um then um theres a little boy there that their bars were this wide and he squeezed through. And they tied a rope to his feet and they shoved him out. And he was swung across and got over you know two hundred feet down and hes got his head down and he goes ah ah and he swings over and he gets up and he goes to the bridge and he opens it. They tie it up and they go down the rope and then the natives start going after them. So he picks up some volcanic rock and he sets the rope on fire. So the natives start crawling all up over each other. Was that one the one with Hayley Mills in it. Yeah. Oh that one. Everything is Castaways. And the natives were crawling over each other trying to get to the top because the rope was on fire. See they set the rope on fire. And the natives were crawling over there was about ten of them down. They started crawling each uh over and the guy was going down and all a sudden he got his foot caught on fire and he goes yeow. Did you see Son of Flubber. Oh I think that was boss flubberdent. Flubberdent. And chew flubbermint gum. And flubberize your home with flubberoleum. I saw the football game. Oh yeah. I like the other you know the second time when they stood on each other. When they just took him. Oh yeah. The opposite team they form the triangle and they got up and they blocked him. Thats funny. First they tackle him but then the second time it went across them and they couldnt get it. I thought that was neat heres a the football guys were all over him and he goes thung. Heres a guy coming at him. He goes the guys standing here heres the touchdown over here and he goes. I like that ninety eight yard touchdown. N o I mean uh field goal. That INFORMAL SPEECH 283 xnn£kstaymwiyk£ybxk wiytaydimep xnnEkstaymwiykeymbxk hiyl£f?hizt£yl hiywazgantuw. wErayyuwztalivepinbEnadiktkEnyan wiyhxda am banCahorsaz didyuwsiy&x?muwviy am ftakxstawEyz. oway oway sosemevit. 6x?waztaf. fttywerem gowiQon&isbowldarmaen. farstaval&Eraz&iyznEytivz 6tyga?kotbay innuwziylend. sow&En am w£n6£yga?ko?bay&en£ytivz 6£y 6Eylaktamin in&is ftishaws awdsna am rawnklifOiQ widaOiqgowiq abrij kayndav. aen&en &En ebaw?tuwhendra?fiy?dawn. sow&En 6£y hiy AagaysEdmEyd am ftCravgat a&arkxptivzin&Er &Eym£ydabigbQrowp wi9 &£rh£rzyanow. sow&En am &En em&Erzalidalbay&Er&x? &Erbarzwar&iswayd aniyskwiyzdOruw. an&Eytaydarowptuazfiyt xn&E?Javdim awt. xniywazswaqakrasanga? owvaryanow tuwhandredfiytdawn xnhiyzgatizhEdawn xnhiygowz ?a?ah xniyswii)zowvarxniyg£?tsap xniygowztuw&abrijaniyowpanzi?. &Eytayitap xn&Eygowdawnbarowp an&an&anEy?vz star?gowanxftaram. sowiypiksapsamvowlkEnikrakxniysEts&arowponfayr. sowftantytivzstarPkroliQolepowveriyCe&er. wez &x?wen&8W8nwi6hEyliymilzinit. yea. ow &ae?wen. EvriyOiQiz kastewEyz. sn68nEytivzw8rkr3liqowveriy68&artrayqtsg£?t8&atapkaz&8rowpwaz3nfayr. siy &Eys£?&arowponfayr xn&snfytivzwerkroliqowvar &Erwaz?baw?t£nevamdawn. &Eystar?adkr3liQiy£ah owvar en&egaywezgowiq dawn ?8n3?8S8danhiyga?hizfutk3t anfayr aniygow? lyyaw. didyesiysenavflaber. ow ay8ir)k&x?wezbasfleberdEnt. flabsrdEnt. aenCuwflebarmintgam. anflaberayzyarhowmwi0flebarolyem. ayQo?6afutbolgtym. owyEa. aylayk&iya? bar? yanow&asekentaymwen&EystudoniyCa&er. wenn£yjastukem. owyEa. 6iyopazi?tiym fteyform ftetrayaqalsm &£yga?ap an&Eyblaktim. &x?tsfaniy. fsrsP&Eytxklam b8?&En&8S£kentaym i?w£nnekrosem an&£ykudangE?it. ay8o?&ae?wezniyt hiyrza &efu?bolgayzwerolowverhim xniygowz 8aq. hiyrzagaykaminx?am. hiygow? ftagayzstxndinhtyr hiyrz&atafidawnowvarhiyr xniygowz. aylayk&x?nayndiy£y?yardta6dawn. nowaymiyn ah fiyldgowl. 284 FIFTH GRADE was that was even more than ninety eight yards because well you couldnt even see it. My dad worked on that picture kind of not an actor but painted the sets. You know when all the glass broke. You know what they did. Its about a million worth of glass in there. All that car glass and everything. You know what they did before they took it. When they they muffled the shot the sound and they shot it out with shotguns. You mean they really broke the glass. Yeah they really broke it. When they um they muffled the sound of the um they took off the sound of the shotguns on the movie. And they shot it out with shotguns. I like it when when the guy was you know he was painting the you know the things and just when the glass broke hed just painted the dot over the eye. Then my dad was on tee vee. It was the Art Linkletter show. My grandfather used to work for Warner Brothers. So we got to go to Disneyland park and things free. My dads got um a friend who works at um Disney studios. Oh guess what we got. See we get a free trip to Las Vegas on April ninth. For three days at the Sahara hotel. Like how. Because my dad was on tee vee. And he was on the Art Linkletter show at nine thirty at night. And he won it. Yeah. I guess so. I think its tough um my dad took me down to the studio one tiirie at three oclock. After I got out of school. When I went to my other school and they were um they were having you know those fights in the saloons. You know in cowboys. You know. So um they started fighting and the guy theyre picking up chairs and theyre hitting. I thought that was neat. The guy picked up a chair and he hit it over the other guys head and the chair broke. They make them out of balsa wood. And um they were playing cards. So this guy says you cheater he tips the table up he pulls out a derringer and he shoots the guy. And the guy he hits his hand you know and blood starts going out. Yeah. Making the movie. Yeah they probably got something in their hands or something. They got a um oh its a little thing of ketchup see and the guy he goes shoots a blank and they hit it and it breaks. Yeah. Well you know about the tee vee program they have these things that youre supposed to guess you know this is about this man and he took off his his um know you know his shoes then took off his socks and put them in the laundry. And then took off his um pants and put them in the laundry and took off his shirt and put them in the laundry took off his undershirt and put them on the uh laundry and you know all he had on was INFORMAL 6ae?wez ftsweziyvanmowr&annayndiyEytyardz SPEECH 285 kazwal yuwkudaniyvansiyi?. maydaedwerkt3n&x?pikjerkaydev na?anxkter ba?p£yntaddas£ts. yuwnowwanol&aglaesbrowk. yuwnowwaP&Eydid. i?tsabaw?emiliyenwer0evglxsin6Er. owl&ae?karglxsen£vri8ir). yenowwe?6£ydidbefor6£ytukit. w e n &£y &£y mafald&aja? &asawnen&£yja?i?aw?wi8fa?genz. yuwmiyn&Eyriyliybrowk&eglaes. yea ftEyriyliybrowki? w£nn£y am 6£ymafald6asawnavda a m 6£ytuk3f6esawrov6eja?gen?on6emuwviy. aen6£yja?i?awtwija?ganz aylayki?w£n wEn&egaywez yanowhiywazpcyniq&a yanow&e 6iqz aenJaswenfteglaesbrowkhiydJespEyned&edaPowverftaay. bcnmaydxdwezontiyviy. i?wez&iyar?liqklEderJow. maygraenfa&eryuwztewerkferwornerbrefterz. s o w w i y g a ? t a g o w t a d i z n i y l a n parkenOiqz friy. maydaedzga? a m afrenhuwwarksae?t a m dizniystuwdyoz. o w g£swa?wiygat. siy wiyg£?afriytrip talasvcygasaneyprilnaynO. farOriydcyzae&asahaerahowtd. laykhaw. kazmaydaedwazontiyviy. aeniy wezsn&e ar?lirjkl£derfowae?nayn 8ardiyae?nayt. aeniywonit. yea. a y g f s s o w . ayOiqki?tstaf a m maydaedtukmiydawnta&astuwdyowantaymaPeriyokbk. aefterayga?aw?eskuwl. wanaywEntemaye&erskuwl en&Eywer em ftEyarhaevii) yenow&owzfay?tsin&asaluwnz. yanowankawboyz. y u w n o w s o w a m &£ystar?adfaytin an&&egay&erpikinep6£rz sn&Eyrhitan. ay9o?6ae?w8zniyt. &egaypiktepa6Er aeniyhidi?owvar&iye&ergayzh£d aen&aCErbrowk. 6£ym£ykamaw?evbolsewud. aenam &EywarplEynkardz. sow&isgaysEz yuw£iyder hiytips6at£ybelephtypulzaw?ed£renjer eniy/uwts&egay. an&agay? hiyhitshizhxn yuwnowanbledstar?tsgowinawt. y£a. mEykiQ&emuwviy. y£a&£yprabebliyga?samsinin6£yrh«nzorsemsin. &£yga? em o w ?itsalidel9iqekE6ep siy en&agay hiy g o w z Juwtsablaeqk aenftfyhidit ani?br£yks. y£a w e y e n o w ? b a w ? &etiyviypr3graem6£yhsv&iyz6iQZ&a?yarsapowzdagEs yanow6isizabaw?6ismaen aemytukofhiz hiz em n o w y e n o w hizjuwz ?entuk3fhizsaksenpudemin&elowndriy. anftEntuksfhiz e m m paentsenpudemin&ebndriy antuksfhiz Jertenpudemin&ebndriy tukofhizandar/ertanpudeman&e ?a b n d n y aenyuwnowDliyhaedon 286 FIFTH GRADE his underpants. So they asked a woman urn uh Im sort of cold would you give me a towel. So then the woman looks at him goes like this. And then and then and then theres a question you knew then the movie stops and theres a question mark. And the guy has to guess what will happen. She gave him the towels. And then my the one my dad had to guess was you know pretty girl and theres this one man who is ahead of her. And the girl had a you know a coke a milk you know and she said to the man um will you please can I please go ahead of you Im I just I have to hurry up its real you know urgent. So he just the man just thought he had a couple of she had a um a milk you know. So the man says oh well okay just for one milk you know so then the movie stops and then a question mark and then no no and then the and then she and then she says okay and you know her husband and then the whole big you know um what you call them again those things that you push around whatever you call them. Shopping cart. Uh food and everything and it was about you know it would take a real long time around a half an hour or something to you know theres so many things in there so then the movie stopped. And the guy and a and. What would happen. Would the guy let him let her go or you know go in there you know. Or would he just feel sad for himself. Or would he say just the milk or just say no no no you just said the milk. So he reached. Thats what he did. He just pushed all the stuff back and every everything started falling off. And they were arguing and everything. So he won the trip to Las Vegas. Yeah. And then there was this other one that that about you know Yvonne DeCarlo. See there were two films that was on. And she had her um hair you know done with uh egg. And there was this movie about it was you know one of the tee vee players um well this woman and this the you know the hair styler said well this is going to youre going to have some egg in your hair its going to be real good and its a shampoo its real boss you know. So they put so they so what would the woman do. You know the woman looked like this to and then then the movie stopped. But she took it. Theres this other one with oranges filled with vodka. It was really funny. One time when I lived up in the canyon there was this tree we had a road about twenty feet wide and we had this this rope tied to a tree and the tree this is the road and the tree came out this far on the road. And we had a rope up here. And Pierre he said you know Pierre. He said hes going to be the daredevil. So he tries it and he swings out over the road and he looks down he goes yea-yea and he comes back and he lands in a sticker bush. You mean Pierre. He used to live up there too. And he landed in sticker bushes. He said yeow. So then um then uh my mom comes out on the porch and um Pierre tries it again and she is looking at Pierre you know. And all of a sudden INFORMAL SPEECH 287 azhizandarpxnts. sow&Eyxsktawuman em ah aymsortakowld wudyuwgivmiyatawal. sow &cn &awumanluksa?him gowzlayk&is. anden an&En an&En&ErzakwEJCan yanow ftan&amuwviystapsan &ErzakwEJ£anmark. anbagayhxztagEswadalhxpan. Jiygeyvim&atawalz. an&Enmay &awenmaydxdhxtagEs waz yanow pndiygarl xndErz&iswanmxn huwzahEdavhar. xn&agarl haeda yuwnow ?kowk amilk yanow xn/iysEdta&amxn am walyuwpliyz kanaypliyzgowahEdavya aym ayjast ayhxftahariyap i?tsriyl yanow arjant. sow hiylest &amaen]8St03?thiyhaedakapal8 Jiyaeda am amilkyanow. sow damsnsEzawal owkEy Jasferwenmilkyuwnow sow &En&amuwviystaps anftenakwE/anmark an&En nownow an&En&a an&En/iy xn&En/iysEzowkEy xnyanowharhazband xn&En&ahowlbigyanow am wadyakolamagEn ftowz 0iqz6s?yapujerawn wadEvaryakslam. Japiqkart. a fudanEvriyOiq xni?wazabaw? yanow i?ad tEykariylbqtayn arawn ahxfanawrarsamdinta yanow&ErzsowmEniyOiqzin&Er sow&En ftamuwviystapt. xn óegay x n a xn. wa?wadhxpan wud ftagay litem lEdargow aryanow gowin&Er yanow. 3rwudiy]ast fiylsxdfarimsElf. 3r?adiysEy]as?&amilk arfas? sEynow now now yajas?s£d&amilk. sow hiyriyCt. 6x?tswadiydid. hiyjas pu/tol&astafbxk xnEvriy £vriyeiQStar?adfolirpf. xn&Eywarargyuwiqan£vriy6iq. sowhiywan&atriptuwlasvEgas. yta. an&En&arwaz&isa&arwan 6x? &x? abawt yanowiyvondiykarlow. siy&Erwartuw filmz6e?wezon. xn/iyhxdar am hiyryanow dan wiOa ah ?Eg. xn? AErwaz&ismuwviyabaw? i?wazyanow wenov&e tiyviyplEarz am wEl&iswumanxn &is 6a yanow ftahErstaylarsEd wEl&isizgona yargonahxfsamEginyuwrhEr i?tsgonabiyriylgud xni?tsajxmpuw i?tsriylbasyanow. sow&Eyput sow&Ey sowwatwud&awumanduw. yuwnow Aawumanluktlaykftista an&En &Endamuwviystapt. ba?/iytukit. ftErzAisadarwanwiOoranJasfildwievadka. iPwazrtyliyfaniy. wantaymwanaylivdapinbakxnyan &Er?az&istriy 6is wiyhxdarowdabaw?twEniyfiytwayd xnwiyhxd&is 6is rowp taydaEtriy xn&atny disizdarowd xn&atriykEymawd&is faron&arowd. xnwiyhxdarowpaphiyr. xnpyEr hiysEd yanowpyEr. hiysEdhiyzgonabiy&adErdEvil. sowhiytrayzit xniyswiQzaw?owver6erowd xniyluksdawn hiygowzyEayEahxniykamzbxkaniylxndzmastikarbuJ. yuwmiynpiyEr. hiyyuwztalivapftErtuw. xniylxndadinstikarbu/az. xniysEdyEaw. sow&En am 6En ah maymemkemzawtan fteporC xndam piyErtrayzitagEn xnJiyzlukinx?piyEr yanow. 288 FIFTH GRADE Pierre comes out and he misses my moms nose by about she goes uhah. How old was Pierre then. Oh he was uh um probably eleven and a half. Hes almost thirteen now. He is. Hes in ae six now isnt he. Uh hum. Were building on our house. Were building on in the to our den and were building the bedroom. So its not going to be so crowded and we can get our brother out of the room. My girlfriend and I decided see her brother has his room and everybody walks through it to get through the other bedroom. And so my mom had the room a room like that and everybody walked through her room. So Andys going to get that room and we said I think the boys should have those kind of rooms then they keep their room room neater. Yeah because everybody walks through it. How olds your brother. Andys ten. Yes. And Im going on eleven. Isnt he kind of uh small. No. Hes about as big as I am. He is. Yeah almost. Um when are you going to be eleven. Im eleven already. Youre going to be eleven May eighth. You know. Your birthday is on the same day mine is. Well mine my Im already Im eleven already. You are. When you going to be twelve. January thirty first. Of next year. Well my favorite sport is fishing. And mine is tennis. Uh we belong to a club. Yeah I got tennis shoes. Well my mom works at a school and she um works uh at a school and and shes a clerk. My father works at a police station. He works nights. And my father works for Reynolds Metals who has companies all over the world. You ought to be made out of tin foil then. And um he uh and my mother doesnt work but uh she plays tennis a lot and we belong to a a club and I like to swim a lot too. Um well I like fishing because uh its a good sport and you can catch a lot of things. But in the lake you cant catch too many things only bass crappy blue gill and trout. In the sea you can catch all sorts of fish barracuda shark maybe even a whale you know. Well my cousin caught a shark once. A baby shark. It was turned up. And it was by the shore. And also the reason I like to play tennis and my INFORMAL SPEECH 289 aen3lav8S8denpiycrk9mzaw?9niymisezmaymemznowzbay9baw? Ja?gowz a?aah. hawowldwazpiycr&En. owhiywaz e am prababliy ilcvanaenehaef. hizolmowstOartiynnaw. hiyiz. hizinCysiksnaw izenhiy. emham. wiyrbeldtnonarhaws. wiyrbaldinomin&a tuwardcn aenwiyrbaldin Pabcdrum. sowi?tsnatgonabiysowkrawded anwiykang€?arbra&araw?ov&aruwm. maygarlfrcnnaenaydasaydad siy harbre&er haezhizrumaen Evriybadiyw3ks0ruwi?t tuwgct&ruw6iya6arb£drum. ?ansow maymamhaed &arum arumlayk&ae? a n cvriybadiywaktOruwharrum. sow aendiyzg3nag£?6ae?ruman wiyscd aydiqk&aboyzjiidhaev ftowzkayndarumz 6cn &£ykiyp&£rrum rum niydar. yea koz£vriybediywDks0ruwit. hawowldzyarbra&ar. aendiyzttn. yeas, aenaymgowiqsnalcvan. izaniykaynda ah smal. now hiyzabaw?azbigazaycm. hiyiz. yea olmowst. am wanayuwgonabiyalcvan. aymalcvanolrcdiy. yuwrganabiyalcvanmcyeyO. yuwnow. yuwrbaredcyizon&ascymdcymayniz. walmayn my amolrcdiy aym alcvanolrcdiy. yuwar. wenyuwgonebiytwtlv. JaenyariyOardiyfarst. evntksyiyr. wew mayftyvritsportizfiJiQ. aenmaynizttnas. ?a wiybaloqtuwakleb. yea ayga?t£nisjuwz. welmaymamwarksaedah skuwl aen Jiyam werksa?ae?askuwlaen aenjiyzaklark. mayfa&arwarksae?8powliysst£y/en. hiywarksnay?ts. xnmayfa&arwarksfarrcnaldzmctalzhuwhaezkampaniyz olowver&ewerld. yuwDdebiymeydaw?etinfoyl &cn. aend am hiy a aenmayma&ardazantwark bad a Jiyplcyztenisalad aen wiybabqtuwa klab anaylayktaswimaladtuw. amwel aylaykfi/iQ bekoza i?tsagudsport enyuwkenkECeladaOirjz. badin&alcykyuwkaentkcituwmcniyOiqz ownliybaes kraepiybluwgal antrawt. inftesiyyekenketolsortsefij baerakuwda /ark mcybiyiyvanahwcyl yanow. wclmaykazinkata/arkwans. abcybiyjark. i?waz tarnd ap. aeni?wezbay&aJor. aen olsow&eriyzan aylayktaplcytcnis 290 FIFTH GRADE mother and my family because you you know you run a lot and its I mean its just a real good sport and we all like it and um also my mother works at yu cee ell ae. But I mean you know volunteer work. On monday and friday I think it is for um the medical center. I like physical fitness a lot. And also theres one person she I wanted to tell you about this. Theres a girl shes um shes about um twenty years old and she weighs about seventy pounds. And um shes um the kind of girl who she lived on a farm and her parents never cared about her or anything and um I mean they just let her do whatever she want and she she went out with mad boys that were I mean crazy and everything and she almost died once and they tried you know a lot of these people tried to kill theirselves. And my mother when she was in her early twenties she worked at a um courthouse. I like physical fitness because I I just like to uh be the well have muscle. So I can ride a bike and everything like that. And I wont tire out after a lots of things. I I rode five or about fifty miles. I rode all the way down to Hollywood and back on my bike. All the way down to Griffith Park and I rode all around there. My speedometer showed fifty one fifty miles and nine tenths. Ive um walked at least ten miles at one time. It was a one gear bike with uh double low gear you know so I could really take those grades and going down hill I just sat back my feet on the steering wheel. Well Jeff that can be dangerous if a car just comes tearing. No I went down alleys. Oh. Well anyway if a car came tearing in the alley youre dead. Well not dead but you know what I mean. Sunk. And also I live in the cooperatives in the co-op cooperative apartments on Sepulveda. And uh we have three swimming pools and its kind of real nice. And my mother did something with the wall. Um she painted half of it on the top and the bottom different colors. And then she put these posters on it. And it says like England and France and Germany Italy and they show different designs and some some of them just show cups. But you know big and small cups and everything. And then on Italy it has a man playing the guitar. Um uh also uh my mother knows some people who know these rich people and we went over there one day. And the shape of their pool is like a ten dollar bill with it had pieces of cement like like uh uh you know like a dollar sign. And uh so I go over there start playing and uh I I swim around that thing and it took me five minutes to get back to the beginning it was real its about as big as this room. But the uh the uh dollar sign in the pool was about oh I dont know about as big as our track. Yeah it had you know INFORMAL SPEECH 291 enmayme&er enmayfaemliy bikoz yuw yenow yerenelad aen i?ts aymiyni?ts JeseriylgudsportanwiyDllaykit a n am alsow mayme6erwerksae?yuwsiyel£y. ba? aymiyn yenow valatiyrwark. anmandcyanfraydcy ayy ae E ow ey a D Frequency (J) and Proportion (p) of Phonemes in Natural Speech. of 1st Grader» Vowel* Consonants f p Phoneme f p Phoneme 7490 2615 2235 1900 1725 1196 976 900 843 711 244 UW U Total Vowels 20,835 2179 ay aw 451 35 ay of Srd Graders Vowels Consonants f p Phoneme f p n .08168 3 8064 .12794 5095 .04917 2884 .04576 r 3305 i 2502 t 2943 .04745 .03969 iy m 2831 .04489 ae 1933 .03067 8 e 1914 .03037 2473 8 .04157 d m d .03782 ow 2383 1383 .02194 w w 1976 .03340 1020 .01618 ey 1 1910 1 976 .01548 .02975 a ? 1862 k .02810 D 875 .01388 1802 i UW k .02743 785 .01245 ? .02694 314 .00498 S 1729 U 1619 .02648 Total a 1184 b h .02022 Vowels 22,650 .35936 .35523 1162 b .01904 1997 .03168 h .03715 ay .01741 953 .00769 aw 477 .00757 g S f 887 .00060 50 .00079 .01323 P ay .01274 f 827 P V .00982 713 y V .00846 599 y .00627 450 0 Q e 363 e .00619 356 .00505 S S 6 217 .00319 i 216 6 .00305 ï 0 0 s 5 Total Total Consonants 35,153 .59933 Consonants 37,855 .12770 .04458 .03810 .03239 .02941 .02039 .01664 .01534 .01437 .01212 .00416 n r t « 4791 2884 2783 2633 2438 2218 1959 1745 1648 1609 1580 1553 1186 1117 1021 776 747 576 496 368 363 296 187 179 0 .08083 .05243 .04669 .04491 .03923 .03781 .03135 .03030 .02954 .02859 .02743 .02568 .01878 .01844 .01512 .01407 .01312 .01131 .00950 .00714 .00576 .00565 .00344 .00343 0 .60060 INFORMAL SPEECH 445 Table 7.2 (continued) of 6th Grader» Voted» Phoneme 3 i »y E ae ow ey a 3 uw u f p 10593 3693 3348 2463 2209 1823 1359 1330 1163 1079 418 .13082 .04561 .04135 .03042 .02728 .02251 .01678 .01643 .01436 .0i333 .00516 Phoneme n r t s d m 1 w k s « ? Total Vowels 29,478 ay 2261 aw 578 74 ay of Adult» ConionatU» .36406 .02792 .00714 .00091 h b g y p f V Q S e 6 Total J s f 6118 4379 3738 3549 3309 2637 2591 2451 2342 2243 2198 1772 1478 1430 1245 1228 1211 1115 1030 668 647 505 360 335 0 p Voted» Phoneme f p Consonant» Phoneme .07556 3 6325 .12985 .05408 i 2489 .05110 .04616 1835 .03767 •y .04383 E 1551 .03184 1229 .02523 .04087 ae .03257 ow 1139 .02338 .03200 uw 869 .01784 .03027 ey 755 .01550 .02892 D 737 .01513 .02770 a 596 .01224 .02714 u 230 .00472 .02188 Total .01825 Vowels 17,755 .36451 .01766 ay 1555 .03192 aw 367 .00753 .01538 .01517 43 .00088 ay .01496 .01377 .01272 .00825 .00799 .00624 .00445 .00414 0 Consonants 48,579 .59996 n r s t 1 d k w 8 m a ? y b h V P f g Q I e S 6 3 f p 3464 2806 2264 2248 1850 1827 1414 1397 1354 1199 1107 988 941 877 793 738 694 692 598 516 397 388 221 215 0 .07112 .05761 .04648 .04615 .03798 .03751 .02903 .02868 .02780 .02462 .02273 .02028 .01932 .01800 .01628 .01515 .01425 .01421 .01228 .01059 .00815 .00796 .00454 .00441 0 Total Consonants 28,988 .59514 STATISTICAL 446 TABLES Table 7.3 Rank Order of Vowel and Consonant Phoneme» by Frequency of Occurrena for First, Third, Fifth Graders and Adults. Data of Denes (1968, Table 2, p. 894) and Roberts (1965) Also Given. 1st 3d (the) (hit) (beat) iy aytt (bite) ae (bat) e (bet) ow (boat) ey (may) (pot) a 3 (bought) UW (boot) a w f t (cow) u (put) aytt (boy) a i iy ay Rank 1 2 3 4 5 6 7 8 9 10 11 12 13 14 a i e ^ ow ey a D UW aw u Dy
Adult Roberts•• 3 i e a u s OW 3 * Rank according to Denes (1963); • • Rank according to Roberts (1065); t In addition to /a/, Denes also used /A/; since for us /A/ would have been transcribed as / a / we have added it to the count. In any event, / a / was the highest ranking vowel in Denes' study, f t These are usually classed as diphthongs but have been added here in order to make our results comparable to those of Denes. INFORMAL Table 7.3 Rank 1st 3d 1 2 n r n r t 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 m s s d d m w w 1 1 k ? a k * 8 t5 a h b b h g g f p p f v y 23 j" 22 0 e s Q e S i SPEECH 447 (continued)
t^ s d rn n r / b\ "—t-^N — d \ Dene»* ^t n b d 1 m — ^ k w \ w^ / \ k k X C Mt s 8 a a » » b h y y b b v ' ' g •» a^K v^ h Nxy P XX'P'C''''' v D S e 6 J 3 ^ g Q I e ^ Robert»** t yt r n wf 8 1 d ht m k 8 a • i b P D D g ^S 8 g S « i 6 e J 24 6 i « S 3 25 3 3 3 * Rank according to Denee (1963); ** Rank according to Roberts (1965); t y, w and h are inflated by use as off-glides. ft Denes used Southern English (i.e., Received Pronunciation) which has distinct •owel phonemes /a:/ (bird), /a:/ (part), /ua/ (poor), /ea/ (bear) and /»/ (beer). In our transcription each of these would become a simple vowel plus r thus bringing r up to rank 4 after •. 448 STATISTICAL TABLES INFORMAL SPEECH < O >H CO w fe 3 3 3 t> n s CO 3 3 SS 2 o» N «o ¡2 -H 1« 9 § s os & 3 00 £ 00 I; t» s s s s t» « c5 09 CO CO ^ 5 C4 t-- 8 1 s ~ 3 I 3 o. £ -o a s _ •S 1 1 §N oo e > CO o i i s i 5* s> e * Q 00 !58 00 A CO 15; ~ * g 8 9 S s $ 2 & «!> Q t> N 8 !? 8 JO S 8 3 i 1 _ •3 « H * J rO 3 » | « 3 a ^ £ Jf •a ® O > __ | -3 « | *>" 3 * ? ! s .5 | S - i m j S N 3 P S —I a CO £ g i s s N S s S s ^ © %§ t—i i R 449 us — ® W «5 t- Ito S ^ $ 2 8 5 g 3 |1 1 •a o I .& ^ I > a q i H CJ STATISTICAL 450 Table 7.5 Product-moment TABLES Correlation Matrix for St Contonant from 16 Sett of Data.1 Phoneme* 1st 1 TRN FOW 2 CAR HAY 3 4 WHI DEW 5 6 7 VOE FRE FRY TOB HUL ROB 1st 3rd 5th A 8 9 10 11 12 13 14 2 3 4 5 6 7 8 9 10 11 .58 .42 .92 .75 .83 .67 .80 .72 .56 .75 .82 .62 .72 .63 .73 .81 .58 .98 .98 .86 .71 .74 .54 .71 .82 .72 .97 .97 .97 .92 .98 .96 .96 .88 .86 .90 .91 .89 .88 .80 .87 .88 .94 .95 .90 Natural Speech 3rd 6th Adult 12 13 14 15 16 .41 .92 .78 .89 .999 .76 .62 .82 .63 .76 .68 .83 .64 .56 .58 .62 .71 .60 .89 .88 .89 .91 .89 .66 .79 .62 .92 .71 £6 .66 .94 .94 .94 .55 .72 .77 .80 .82 .80 .68 .73 .76 .90 .81 .60 .70 .91 .91 .94 .91 .91 .82 .62 .75 .99 .93 .93 .94 .95 .92 .92 .83 .64 .80 .98 .99 .96 .93 .90 .82 .66 .84 .93 .97 15 16 1 Sample sources: 1, dictionary; 2, modern prose; 3, modern plays; 4, lectures; 5, modern prose; 6, newspapers; 7, radio announcements; 8, telephone conversations; 9, phonetic readers; 10, telephone conversations; 11, modern plays (same data as CAR, 3); 12, isolated words from written materials spoken in syntactic context, then re-isolated for phonemic analysis; 13, 14, 15, and 10, phonemic transcriptions of our own data (1st, 3rd, 5th and adult speech, in that order). See discussion in text for details. Phonemes used: t, n, r, s, d, 1, k, m, w, y, s, v, h, f, b, g, p, q, S, 6, 3- INFORMAL SPEECH § i £ N11if 1 £ QOHQQQONnQion$%c>s> N N CI N «^00 8 .-iioeococst^-Heo;»'«» CO © to © in w Si F-H CO o t» v« wu ^r «v r» a c X 95 co 9S c^ e^ c^ N s o a n e s o c ® CO -H s o £ 3 in a s y ? 1 104 0 0 0 144 57 40 156 1 1 0 3 14 11 85 62 133 182 5 1 79 1 5 0 1 9 93 18 38 5 0 0 51 39 1 75 29 25 416 0 0 0 0 279 2 7 2 0 0 19 33 50 56 6 15 313 1.56 206 12 18 368 53 153 9 45 220 114 313 147 4 40 3 19 19 11 6 33 79 2 6 2 0 3 3 68 162 86 419 71 11 56 62 121 15 10 129 86 170 12 0 0 0 0 30 1 3 3 3 32 2 67 91 423 0 0 1 8 316 0 1 2 0 23 0 15 22 13 47 20 1 3 0 8 8 1 0 0 2 0 0 0 0 0 0 1 8 2 0 9 3 1 273 93 0 1 9 233 0 14 0 0 0 0 216 1 1 109 0 0 1 4 2 0 46 2 7 2 2 23 2 8 22 10 32 9 47 15 11 3 0 1 13 0 0 10 448 10 11 270 0 0 0 0 0 3 ,Space 0 54 2 64 0 72 68 18 2 1 142 58 46 49 21 37 16 70 63 91 0 8 75 2 6 38 5 0 0 19 0 2 0 0 4 6 24 21 42 5 28 237 22 31 22 64 7 6 139 182 423 479 316 65 107 314 238 295 1 54 6 12 1 367 64 11 0 15 1 342 3 20 96 101 275 194 6 0 79 2 0 2588 Hod Symboi 41 9 22 132 7 43 20 10 1 7 95 119 155 235 165 34 75 229 177 307 0 27 1 15 0 217 75 6 0 16 a b 6 d e f K h i V j k 1 m n ow P q r s t u V w s y z uw ay 3 e 1 ts 66 3 se 0 14 aw ay 21 ey 66 138 iy ? 39 5 3 0 Space 0 Period STATISTICAL 472 TABLES Table 8.2.4 r IT si Symbol a b i d c f g h i I k 1 Frequency of Phonemic m 1 7 22 32 12 1 32 3 41 3 12 5 0 14 1 0 2 26 0 0 0 100 9 0 57 0 1 6 1 1 0 4 2 27 0 4 2 9 0 4 16 13 24 14 3 4 16 10 4 8 249 8 1 4 12 2 81 3 3 78 2 7 64 214 33 1 14 2 0 4 20 1 1 2 51 0 4 21 1 0 41 4 1 34 0 0 7 0 0 99 0 1 9 13 0 0 0 6 0 0 2 22 0 0 0 5 22 150 1 0 32 132 85 44 0 89 22 « 21 1 0 1 0 29 0 2 17 0 0 0 0 J k 35 5 7 5 29 2 7 121 2 1 56 8 5 1 52 20 5 66 48 28 16 11 116 7 16 29 21 m 21 36 0 10 87 10 15 9 74 0 7 5 19 ii 69 29 19 154 95 37 36 51 120 52 29 63 34 ow 1 20 4 21 8 12 6 18 51 5 31 68 36 1 1 0 27 1 31 0 55 6 0 2 67 4 P 1 6 0 4 7 4 28 3 97 5 9 8 7 q r 35 48 6 162 91 60 33 29 172 21 77 58 53 8 7 24 6 34 111 27 29 17 123 26 125 35 37 t 23 24 0 8 84 18 6 19 124 4 19 15 17 U 0 0 0 93 2 0 0 0 0 6 37 14 9 V 2 16 0 19 60 6 8 14 54 1 9 9 10 w 33 0 0 1 263 1 144 0 0 0 0 0 0 1 0 5 0 2 0 2 1 5 0 18 0 0 s 2 0 0 1 0 0 134 0 6 0 0 0 0 y z 1 26 3 28 8 23 17 17 69 15 25 16 18 uw 1 11 0 34 12 4 24 21 33 10 35 100 30 ay 0 0 0 5 1 2 1 0 0 3 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 3 6 0 0 0 2 2 1 5 2 224 0 5 4 0 9 1 0 0 0 201 2 0 4 88 1 0 0 0 3 3 241 64 329 17 110 153 201 10 69 131 363 378 se 0 16 4 101 1 40 1 12 45 26 31 3 3 aw 1 2 2 33 2 0 0 2 3 1 7 6 13 4 12 1 163 5 33 44 53 23 18 200 70 135 ay ey 4 22 0 52 6 20 27 0 9 18 84 17 50 6 39 36 65 15 33 57 47 41 12 80 114 45 iy T 3 26 2 21 7 11 14 19 35 8 32 27 3» 3 0 9 11 19 0 21 6 2 2 6 26 180 8 Space 22 183 11 115 42 70 42 191 255 37 62 68 81 Period 0 0 0 0 0 0 0 0 0 0 0 0 0 Total number of pairs, 54,478; diphone pairs only, 44,545. Total number of phrases, 4,140. Total number of utterances (full stops), 1,630. a b t d e f ft h i n ow P 38 2 1 15 332 5 3 1 475 0 6 11 2 130 132 4 3 71 28 8 2 9 1 0 0 26 57 6 0 2 0 1083 331 78 123 53 123 33 142 128 0 0 8 1 96 0 29 119 39 1 8 26 28 54 297 3 20 0 49 131 24 0 2 7 13 3 23 1 0 0 1 26 8 0 5 5 0 12 4 0 97 0 12 l 0 0 0 0 9 0 7 0 0 0 2 0 0 0 18 455 1 0 4 0 18 0 32 0 25 0 28 0 0 0 2 20 30 0 0 60 1 7 1 0 3 0 0 0 0 0 0 0 14 0 10 0 0 0 0 0 1 0 0 0 192 10 30 10 1 0 22 0 13 0 1 89 0 20 4 17 39 0 0 0 q Diphonea, r 150 23 1 47 288 77 80 0 18 2 26 11 2 26 63 81 4 9 18 126 23 60 3 1 0 18 30 0 0 47 1 1157 11 8 17 40 108 5 182 43 0 a t 9 65 4 0 7 0 35 14 112 55 1 41 1 3 1 0 185 202 1 0 140 84 35 23 9 26 162 237 43 34 16 25 9 22 160 74 41 345 259 6 13 4 23 27 1 0 0 5 0 0 29 35 31 26 7 0 0 0 8 2 0 0 354 248 79 139 9 62 85 81 37 58 82 49 103 125 8 20 171 105 0 0 INFORMAL Adult Speech, Arranged SPEECH 473 Quarirolphabeiically. oymuu*U V 0 3 9 0 1 0 4 11 1 115 12 0 34 0 2 0 0 58 14 0 18 0 16 11 0 2 0 7 2 27 22 0 0 0 7 15 3 6 15 7 0 0 0 0 41 0 19 0 9 0 1 11 0 22 0 0 0 0 0 0 0 0 0 184 0 121 0 0 0 57 0 20 0 42 1 0 0 12 1 6 0 0 w s y z uw ay 3 0 2 2 0 2 0 0 0 0 4 8 5 10 9 0 3 1 17 2 21 3 67 43 114 0 6 14 0 24 0 0 2 0 36 2 1 0 9 0 7 5 0 0 35 0 0 0 27 0 1 24 0 155 0 0 3 0 2 0 26 17 34 14 17 3 71 0 37 2 33 34 15 1 17 1 11 32 13 4 68 19 110 55 12 5 32 10 22 53 0 0 5 0 5 1 7 2 8 0 4 35 0 0 46 7 51 111 37 1 61 1 18 0 5 0 63 4 16 0 157 0 0 4 1 0 0 0 12 0 23 14 0 1 1 0 0 0 0 0 1 0 1 0 1 0 0 0 0 0 358 0 30 5 21 19 1 0 47 3 17 23 0 0 0 0 0 6 0 0 0 0 0 0 0 0 3 0 5 0 0 0 0 0 0 1 0 0 92 31 49 272 0 0 0 8 0 12 0 0 5 1 1 9 0 0 103 5 8 35 2 0 29 28 9 16 0 0 92 3 18 94 1 0 91 6 19 9 0 0 0 0 2 27 0 0 426 26 361 6 0 0 0 0 0 0 0 0 V a se aw ay ey 0 0 12 6 1 0 Q o 2 217 37 100 0 0 2 63 11 1 0 1 41 479 19 28 0 1 7 26 1 0 0 0 10 158 21 4 0 0 0 50 5 0 0 1 0 81 235 74 0 64 16 13 0 0 0 0 0 196 1 0 0 1 60 322 60 9 0 9 52 249 78 3 0 47 12 159 42 4 0 38 173 390 26 47 0 4 45 29 0 1 0 3 23 122 26 6 0 1 21 40 2 2 0 11 71 230 56 36 0 6 36 333 38 11 0 11 47 504 16 5 0 0 0 2 0 0 0 5 47 227 7 4 1 0 0 0 606 0 0 0 0 80 1 3 0 0 0 384 1 2 0 3 56 174 10 1 0 11 39 65 1 0 0 0 3 3 0 0 0 0 0 0 0 0 0 1 4 19 1 5 0 0 0 466 273 0 0 23 86 16 4 0 0 5 1 7 2 0 0 7 5 9 0 0 0 54 14 36 10 1 0 3 9 21 2 0 0 52 25 106 13 5 0 10 79 41 4 8 0 1 2 2 0 0 0 16 353 387 225 6 0 0 0 1 0 0 1 24 4 57 4 44 27 37 0 1 27 231 85 114 33 0 3 109 60 77 0 4 60 2 1 21 5 0 0 0 0 7 0 2 5 1 19 17 1 472 0 ¡y ' a Space Period Symbol 0 1 39 0 18 142 0 3 3 0 8 1 0 42 130 0 27 0 0 47 0 3 26 0 52 18 1 0 35 6 116 0 12 0 0 214 4 1 36 0 1 19 20 0 83 58 188 2 48 49 116 1 35 40 176 92 40 0 0 3 10 15 70 0 7 0 0 5 4 56 294 22 36 40 109 11 32 78 78 2 46 0 0 19 0 5 15 2 6 45 123 1 61 6 41 0 2 0 29 0 10 7 13 0 19 11 2 4 4 0 0 0 0 0 0 0 0 0 3 0 20 213 74 0 3 1 1 192 8 0 0 185 1 0 0 63 0 0 3 36 8 0 3 11 8 15 5 9 13 1 0 12 0 0 0 14 0 9 12 12 57 0 0 0 0 44 12 12 94 4 25 5 64 3 11 46 146 82 253 190 25 90 190 162 150 0 29 3 8 1 180 77 2 0 14 0 189 2 15 72 47 147 110 5 2 1629 a 37 b 10 i 13 d 57 e 3 f 22 7 S h 9 i 1 V 5 J 41 k 1 76 m 69 n 134 ow 94 14 P 62 q r 182 108 8 t 180 u 0 5 V w 1 3 J 0 y 124 z uw 68 2 ay 0 3 7 e 9 0 a 49 se 2 aw 15 12 »y ey 38 122 >y T 54 3 3 1 Space 0 Period STATISTICAL 474 TABLES Table 8.3.1 Rank Order and Frequency of Word-initial Letters for First, Third, end Fifth Grade and Adult Speech Rank 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 First Grade Frequency t a i w h s 0 m b g u d c f 1 y p n k e r j V q 2 X 2934 2276 1833 1617 1313 1275 1064 1028 890 763 693 665 632 521 451 451 354 294 271 265 263 137 33 3 2 0 Third Grade Frequency t a i w 8 h 0 b m u g y d c f 1 k P r n e i V q s X 3239 2458 1824 1721 1518 1424 1112 923 871 844 758 642 635 602 521 494 365 358 333 307 227 152 29 3 3 0 Fifth Grade Frequency 3952 2991 2141 2136 1976 1748 1404 y 1117 m 1061 b 1028 978 g 910 d 811 u c 743 f 701 1 686 553 P k 520 n 467 424 e r 410 223 j V 53 22 q z 10 X 0 t a w i B h 0 Adult Frequency t i a w 8 y 0 h d b m g c 1 P f n u k r e j V q z X 2469 1733 1529 1227 923 895 769 708 592 588 497 465 439 427 361 359 338 317 300 241 258 174 60 18 7 0 INFORMAL 475 SPEECH Table 8.3.2 Rank Order and Frequency of Word-final Letters for First, Third, and Fifth Grade and Adult Speech Rank First Grade Frequency 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 e 3663 t 2253 d 2025 8 1966 y 1454 n 1343 0 1124 r 970 i 925 m 644 612 a h 611 562 g 1 495 w 333 u 301 f 262 k 216 185 P 42 X 37 b c 5 1 s 0 i 0 q V 0 Third Grade Frequency e t d 8 n y 0 r i m h 1 a g w u f k P b X c • j q V 3883 2382 2342 2123 1404 1296 1233 996 788 783 653 576 563 551 447 420 324 315 227 30 23 9 1 0 0 0 Fifth Grade Frequency e t d 8 n 4927 3249 2703 2797 1687 y 1585 0 1452 r 1351 h 934 i 852 817 g m 759 732 a u 723 1 707 w 578 f 450 k 401 P 254 b 37 c 32 X 30 8 11 0 j 0 q V 0 Adult Frequency e t 8 d 2580 2158 1444 1237 y 975 0 969 n 880 h 733 692 r i 677 u 617 1 540 529 g 422 a w 350 f 326 m 217 k 205 101 P b 15 11 X c 7 I 0 0 j 0 q V 0 STATISTICAL TABLES 476 Table 8.4.1 Rank Order and Frequency of Phrcue-initicd Phoneme» for First, Third, and Fifth Grade, and Adult Speech. Rank First Grade Frequency 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 w 561 3 547 SB 480 ? 454 ay 423 ts 374 h 302 8 256 m 254 b 198 186 y i 153 n 139 t 135 d 127 k 126 f 107 88 g s 88 84 e 61 P ow 58 3 55 1 55 r 50 e 37 34 a 27 J 17 i 11 iy V 8 aw 7 ey 6 c 4 uw 2 2 u 0 ay 0 0 3 Third Grade Frequency ? w » a 8 h ay 669 634 518 472 452 346 323 314 y 8 302 m 195 b 192 i 179 n 166 t 142 k 135 d 109 f 109 1 99 85 K r 76 s 74 59 p ow 56 3 48 1 47 41 e a 31 e 29 20 •y aw 12 uw 6 6 6 z 5 V 4 1 ay 1 ey 0 3 u 0 0 3 Fifth Grade Frequency Adult Frequency 3 775 w 745 ffi545 ts 522 520 y ay 448 h 412 8 331 ? 270 b 251 i 244 m 241 n 216 s 209 t 184 d 177 k 138 f 127 1 104 ow 103 g 101 85 P e 80 3 79 r 65 58 J a 45 e 44 11 •y Ö 10 aw 10 ey 10 t 7 uw 4 V 4 u 2 1 3y 1 9 0 3 ay 472 w 426 3 387 361 y 3 353 i 255 e 225 h 191 b 183 8 171 n 128 d 115 t 105 ow 97 m 81 f 70 1 68 k 62 3 57 r 43 e 42 42 g 39 P V 37 J 26 S a 22 e 16 ? 12 •y 12 £ 11 ey 9 z 6 V 6 aw 6 u 1 0 3 0 ay uw 0 0 D 477 INFORMAL SPEECH Table 8.4.2 Rank Order and Frequency of Phrase-final Phoneme* for First, Third, and Fifth Grade, and Adult Speech. Rank First Grade Frequency Third Grade Frequency 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 n 580 m 553 482 i r 432 t 412 iy 383 3 365 8 293 d 277 ? 205 ow 205 1 194 ay 141 k 131 uw 113 ey 112 0 105 70 P 67 8 f 51 44 e V 43 b 33 31 a 6 28 i 25 e 23 s 22 aw 22 21 b ay 13 ® 12 12 3 V 9 J u 5 w 5 8 1 1 y 0 3 n 659 m 609 i 490 r 486 t 472 3 386 »y 363 B 332 d 331 ow 304 1 221 ? 180 k 177 ey 140 uw 124 Q 118 ay 110 P 106 V 47 42 f a 36 6 33 32 g s - 32 aw 23 e 19 h 18 e 15 ay 15 b 10 3 8 i 7 5 J 4 w 2 y es 2 5 1 u 0 0 3 Fifth Grade Frequency n t i m r ow 8 iy 3 d 1 k ? 0 ey uw ay P a V f h 6 g aw e e s 3y b V J 3 i w « V u y 3 714 602 584 578 543 481 415 413 408 369 301 234 233 182 167 139 117 99 83 81 74 74 50 42 34 31 29 27 17 14 13 11 8 7 3 2 1 1 0 Adult Frequency n r t a ow 8 iy 3 1 ? V d m uw k ey ay a h f P V aw 6 b 0 I K S 3 e 3y i w s y ts 3 u 387 372 330 304 284 270 269 238 222 164 152 151 151 145 87 85 84 81 73 47 39 34 30 25 22 21 16 12 11 8 7 4 4 4 4 1 0 0 0 STATISTICAL TABLES 478 Table 8.5 Proportions of Vowels and Consonants in Word^imtial, Word-final, and Overall Position for Letters and Phonemes, for First, Third, and Fifth Grade, and Adult Speech. First Third Fifth Adult .306 .403 .401 .303 .383 .401 .287 .379 .405 .294 .398 .414 .338 .265 .401 .287 .258 .399 .328 .266 .400 .383 .301 .405 .694 .597 .599 .697 .617 .599 .713 .621 .595 .706 .602 .586 .662 .735 .599 .713 .742 .601 .672 .734 .600 .616 .699 .595 Vowels Letters: Word-initial Word-final Overall vowel* Phonemes: Phrase-initial Phrase-final Overall vowel Consonants Letters: Word-initial Word-final Overall consonant Phonemes: Phrase-initial Phrase-final Overall consonant * In the over-all counts for letters, y has been assigned 70% to vowels, 30% to consonants on the basis that only y-initial is consonantal and about 30% of the total y count is y-initial. TABLES OF TRIGRAMS 8.6.1 First Grade Tables of Trigrams First Grade U65 504 th my 382 . a 322 ome 251 li 222 ow 1572 480 my the 381 um 319 so s a 248 tha ve 221 mo 1322 464 aid hen 1292 456 nd he 1267 435 ai ha e t 1010 he 433 ing 913 i 431 on 654 to 413 wh 643 wt 403 go 552 to 396 nt S46 her 393 es 544 en 389 hat 5)2 a 387 at 518 d l 385 wa 507 er 373 um 371 me 366 yo you 362 it 361 ng 353 e a 350 . i 336 do 333 e w 329 t t 328 we 323 e. 316 ere 247 e i 314 in 246 ts 308 n t re 306 is 293 in 292 U ut 284 as 282 ou 278 s. 268 ca 264 thi 257 t 245 ed 244 oth 243 it 237 ho 236 was 234 d i 229 e h 219 se 217 ot 215 t a 208 one 207 e s 202 be 192 n i whe 191 ave out 190 she 197 ne 196 d a now 136 fo no 170 ad kno 149 e 8 wha 108 W but 0 s 148 hi 184 use 164 t w 147 ba 183 e b 161 of 144 got 181 hey 160 ou 143 an CO 159 ime ter 142 e m 179 ey o t 158 al 178 ke 157 di 141 is r. s i t h y m 156 8e ent tim 140 st uh t 0 228 sh 195 of 224 . w 194 all 174 et 193 on 150 e c 165 y- 176 kn hav 223 s t 109 e d eve 188 his 180 201 •y 137 121 (con t.) d h ike st 171 . t our 152 bu 8« 172 som 173 e o t i 155 sa go 138 d. ver 134 ur 133 d s eli had 130 lik uh 129 . 0 hin i w 128 d m le 127 e f n a 126 th 125 or 122 •y ste 154 me 480 137 bi 119 br 118 eau 117 r a S 0 116 up hes 115 < g y t 114 s s wen 107 si . s mes 106 fr . h i h t s 105 pia 104 da 100 Pl ant g99 a b h. o g up 98 d w s h tie wer y b y s 97 ju 96 at er. 113 ee g t ght y w 103 tw ame aus its rea 94 ht igh 0. wel 112 wi e u so y « 93 d u n w 111 im n. 110 fi met 102 bec can 101 d o eca ont s w 92 ti u k 91 ma did ith 91 (corn.) t m 90 bro itt om way 89 re day don ers es. ran 88 lo iy m. two y d ys 87 n wit 86 t b 85 lay n h r t 84 ea ye ce gra oes 83 bo . m i c 82 com for id y f 81 wo bou hou mot 80 e1 hom oui t d wo 79 ld 78 U att ch i d 1t r h uld 77 fa se dnt ive m a ove own 481 T A B L E S OF T R I G R A M S 77 67 (coni.) (COflL) t U ays ine 76 g a s m 75 m t 74 cl te big n s ool ous ttl 73 ab abo eti und y g 71 66 alce ft goi ree yea 63 . n a 1 cou hem oun r s too 64 ast ist ng. o i s b thr se at. ck lit oin 63 not su w w 70 ev o m o w 62 pu dy y ' 59 de dow h e P min rot sta 68 h a m i me. y h 67 . u 61 Ici ery kin 1. ry 60 le mi end ig ust 1i re. t ide n m nce 58 na d o 57 ov Pe ra cho do hoo i 1 i s it. old res t f 56 im jus o h sch 52 oh ro ay eat eas ill m s o b r b s f s n w t 51 ri a c a s dad eah eth one t k t 1 tee wn t g 55 e n fro nam ugh y c 69 . b 53 (COM.) 54 ne ack alk ate ath n o ol r w sis 50 cat dog idn 49 ar sw bab rie see swi 48 by e r ose roo t 53 ear him c tch tur 47 ot al fou h i m w 43 39 35 32 28 (cont) (cont) (cont) (cont) (con s 8 wim 0 0 oh r i tin ven wan y o y u 46 or ait eat ish les m h n y ndm ook rou 45 fe us any aw e e e y han Ics 1 a ore rom 44 eh la tu d y hre ind nin ny o p oom saw ss te 43 ni ate ne. 42 PO ds h m how ock s 1 sho 41 d b gs ien k a mor put say w. wat 40 a d cam din een em fri i t ies irt k. nd. no ty 39 add ah aid are doe ets ff g • h o ed. hol eet loo n u man nds mom ns nly s r onl ow. 34 sai su awa t y ean 38 et. . d fat ess i k i u imm lot let m o 1k o a lly t e PPe ted r o ump se. sed tal 37 unt P> tr who ead h w 33 has a h ick » P off a t r d aby alw Tg fiv tar tho go 36 eep m m mon o d P a s d sh snt tak urt 35 cr g> ar e k ' P jum 1 o lwa u g w i 32 gu •g air bac ddy en. hos Is m g o y r c ne rte w a wou 31 hu mu si ach boy mmi per s c ten wor 30 de ir 1h Idn lie loc r f 27 bl g» ace ain ars ask car d c e j ep hir 1s 0 c ons s e ut. P« d d dma goe hy 26 ite ani lac mmy bed o r bie 0 u cal em. oug r m ese f. six h h 29 hea un i m est ie Iiv hit mea °g ost nés ood P ° P t Prow rin unn sid son wal t r 28 une a g bir 25 aw bit cha if h u ol 24 25 22 20 19 (cont) (cont) (cont) (cont) (cont sp ee. esn ew g* i i if is. 1w nny omm on. oot ork orn ped ske sti ure 24 dr ei fu a r aid aug che der eig eie ett fa gb im. ins k i kes lee los m b mou ndy no. oke oil rab rig rni rs. s p tor u c y1 23 eg a a a w abi ade ah. bal be d f dg d1 eac egg fei gue ix 1m low m u n e ngs oie ors pin rai rd ren rid san sto tel tra urn why 22 by el oc bra dp fis h b hs hai ink irs k t lut las U. mos nk nt. ong or. qui r e rty ts. uh.* whi 21 11 ke ve . f a u ang aro i a ' j int n c nti oc! 00 oor pan r u tay til u w w m 20 as a. ass b. bea cke dy. el ext fie fun g P g s ge m hor lin ma mbe med nde nex nge ol. r P red rt rtl sie uch ues w h xt 19 pr sq . e ady aft bas chi col die dre fin fir ft gre ice iff ig1 u led Ion n f ner nig ns. nte ok poo r n squ tai top tyu d 18 a f a m ano bun cks eli d e d n ept f h fy ff. ger hro ian in. ked mak mue ney nie nts 00. oon P i rei s y stu t n ton tty us ves 17 ag du . r bbi ber ble ck. eek fee g » g w h y 482 FIRST GRADE 17 14 7 7 16 13 12 6 6 U 10 9 9 8 5 (cOflL) (COflL) (conL) (cent) (cont. (cont.) (COflL) (coni.) (cont.) (coni.) (cont.) (cont.) (cont.) (coni.) (coni.) bot hun ied ifd irr kL mad mal n b n g n1 ned nne nni oy pen r1 r r » j sin u s up. yn yes yin 16 ati dmo ds. eed els eyr fw gh bal har hoc i f 1b 1d m d m f mp nsi nto ny. og» op ope P« ire rst st. sotie uff uir un uts wee yre 1S af j> Ica sn . c ail aim era dpa. fi f m fai ffe foo gir i 0 kit lan le. mas mpi neh ndp org rks rth sev te. th. tte twe u h um. wn. 14 ac au nu sk .1 bla deb doo gd g m ht ion irl k h Uo Imo mil mov n d of od om. opp Pig pie rac ret sii tuf uth ved wai y k 13 ru abb as. aun ce. do. eak ebr ey. fer gl hda hig hop i b inn ise jim my men ndr new nis o e og. ond ots P» me run tea thd tre tti u. ull w s wy X. 12 en an. bil bod dif e v efo eir ete flo gav goo gro h c h p hei id. il ker 1 c 1 y lar lau lim iy- m n nev nut 01 ody ou. pre ra ras rd. rn sh. »P tes win ye y* 11 ce jo ad. aii alf arr avi bag bar bet ch. cri d r de. dol eft ene ens eop gh gar hf haw hed hic imb k o kat kee ken lad lef 1er lie lor m c mud n p n r nea nee nty oda olo opl ort ott ows peo P" ryt ses spa sso tan tod tsi usi ve. vin w o ws y rp y yth 10 lu •j •P ami ane ank ari ash ban bef bon box bre cla de ero dia erd exi far fas gam giv hap ho ich ift igg ils ima ke. kid kil 1f lev lif lki lia Us m p mex mis nda nim nke nyt oki oli ot. oys pas P vo a o a q a v acc ada ado adr agg agn ahu ais ajo ak al. aid air ana arg ari atz au auc aud awe axi ayg b a bbl beg beh blu bly bol 2 (COOL) bub bug by. c b cad cap ced cey ria cit ckb eld cot coy cry eye da. dda dds dew dit dne dug dus dyb dyn e z eak eaw edn eds ege egu ehi eho el. elb ely enl enu epl epp erl ern err ert erv eta etb evi ex exc 2 (COOL) eya eyl f j f n fiu hs fav fil fli flu ge» ggo ggy ghb gho gis glu gni gos gul gum hk hv hab hac hbo hie hih hmm hti htt hum hut hy. ia. iap ias iev ill ihu ili ilt ilv inv ip. iso ito itu ivo ixt iza jam 2 2 (COOL) (COOL; jea jim jo« nuk nvi nyg nym ¡or kah kat kba led kle kni 1k lak Ibo Mr leb len lex Iga lia Bp liz Ike Ire m j maj mam mat mep mid mm mow mpt mum mus na. nae nag nan nap nas nat nau ndf nee nim nle nno nnu nsw ntr ntw nue 0 V oad oan oap obb oca ogi olf olt onn oos oro osh osp ote oxe pc Pg P " pa pad pag piz pon por pot PP> psi pty pud pum ra ra. raz ibr rcy rdl rey rge ria rib riv rle rlo rme rob ror rta 490 THIRD GRADE 1 2 1 1 1 2 1 1 1 l 1 1 (conL) (cont) (com.) (conL) (conL) (COOL) (conL) (conL) (conL) (cont.) (conL) (conL) rue rum rve ice tia tie ska spi wis worn ws. wuh X i X. xe* xis *ro tu tsr ycl yd> uy (b (UZ ygr yla ymo yna za. zar zza «y •ytap tat tau tew tfi tir tit tly toe toy tto tua tud tue turn tzo ua. uah ud. udi ue uka ul. umb ume uri urk urp uta var vey vie voc w 1 wag wbo yet 1 ed «1 eu «h i. ka 0 vu vy aah aci adl adv ae. aeo afe afr agh ags ahd aii ale •Ig alu amy apb apr apt arp arv ago asu asy atf atr ava awf awn •yb az. azi azy b c b i b m dau dec dif dil dli dma dn. doc dod dop dor dpa bby bew Mi bru bst dti dub dve dyg dyi ea. eag eb ebi ebu ecr edd bt buC edg edt c a c g c. caf cce cci cec cdy eeo eer eew cep ehl cht eig eim cin ckt clu coc ct. ctl cts cud egeg" ego bp b r b t b u bah baw cul cuu cys d v das dat eez efa eff egs egy eid eil eks elm emo eol eor eow epb equ erf ero esc esk etu etw ety eur eva evo ew. ewe ex. exa eyd eze f e f r & fak fe fer fet ffe fie fix fina foe fol fhi fti film fur 8 j 8« gad gae 8at gegeb gel 8eo ggl gi gie gig gn gne gns god gog gor gua gup gus gye h j hag hak hau hd heb bet hh hhh hi hi. hla hme hob hog hoi htw hu hue hug hup hus hwu > y ial ib. ibl ic. ici icr idg ido ieg iel ier ife iga igi ii ila ilk ilm ilo imo ims iny ior iou ipm iro irw isc isy itf itl iva ix. izo jad jar JM jef jen jer joe j« jud jui jul juv kg k j k P k r ka. kir kos kso ku kul lai law lea Ids leh lfm lfr lix lm. lme loa lop lpe lph It. lte 1th lub lum lus m k m v mai mbl mee meh oev oft mey mie mok oga ogr oie oil oky olv omu omy oni onk oob oof 000 oop opi orl os. osi osk otc otg oww mol moo mp. mph mpk mpl mpo mpu mse n v nar naz ncy ndp neo nep nga ngo ngy ni nil nio niv nlca nki nlo nna nns noo num nyb nyh nyo nys o j o z oak oal oas oba oby och odf odg odi ods oc. oyf pd P e pf P P paw pbr pes pew pho phr phu phy pki pli pme pol pou pow pox ppl pse ptu puh pur que raf rai rbi rcl rco rcr rdr rfi rfu rio riz Hd rlf rli rna rno rat ro. rov rp rpo ira rsh rsi rtn rus rvi rwe sac sal sap sav sba sef shh sk. sko sky slo smi smo sod sof soo spy suc sud sul swa ta teb tec tem teo tgu thm tht thy ti. tid tif tiv tll tne toa toe toi tsk tso tst tt tt. ttt tue tut u b u y uac ubt uct uda ueb ued uge uhw uic uip uit ule ulg uli ulp umi upe uro urr usb uum uve uza uzi vol vom vou vu] vy. W j w n waa web wfu wid wie wl. wsp wwu x b x k X 0 x r x s x u xac xce xci xpe xth xty y q yac yba ybe ybo ybu yd yee yeg yfr yho yst ywh z. zan ze. zi zie zli zo zon zos zy. zzl 8.6.3 Fifth Crade 492 Tables of Trigrams Fifth Grade 2620 709 th her 491 on 423 as 379 n t 310 my 276 t w 2010 638 the a 486 sh 412 now 377 Icno 307 my 275 lik 1578 627 he to 1480 620 nd e t 475 U 473 do 1479 617 an ng re 1400 613 and d t 459 t t 868 yo 604 it 454 e a 862 i you 571 ha 451 wh 546 wa 449 ut 545 go 444 thi 540 en 438 e w 839 we 794 he 782 to 747 ing 734 er 710 ou 534 hat 461 435 so 529 es 432 s a 515 nt 426 ed 504 at 425 it 409 um . a e. 405 li um 404 ere ow 399 ve 396 she 392 hen 391 kn 376 in 302 all 273 ver 294 ey 270 of 363 was 293 me 268 d i out 358 t. 292 e h on 365 tha 347 we 346 . w 343 s. t a 337 ts 265 t i 290 •y 263 his 288 ike 261 ad 287 be 285 ell 260 ave 257 ye 389 e s 332 hey 284 ot 247 e 8 387 in 330 Ice 282 u k 246 CO so 381 is 380 . i 320 of 316 s t 280 ca hin 279 St 243 d s 242 no e i 238 ay eve one 235 hav 231 St 229 se 228 ome t o 226 d a 225 di 210 yea 208 bu or 207 mi 206 an 205 o t 204 d h 201 whe fi oth ter 220 ne 198 . t 219 al sa 196 fo 212 ent 211 our 173 (conL) 186 e c 184 mo ght S0 183 ee 182 e m s i 181 re t s 200 224 hi 213 e o 187 te e d 195 et 190 h. use 188 hes s s 180 uh . s wel le 159 is n. 142 don som 172 ou ont 155 ge id 140 e P 170 had 154 ev get igh 137 wi 153 up 136 er. 151 r t 135 . 0 jus up 169 me 168 wer 167 ma ive 165 se g t 164 r. 179 got uh 163 ur y- 178 e b 162 wo but n i 176 n a t h 174 wha 173 eah 161 did rea 160 ab ju 150 . h ust 149 ba go oin ys 148 abo 146 bou for 145 ho ly 143 d. 138 r a 134 d w pla 132 ey 131 day 130 yw 129 bo ht 128 im its Id 127 ar d o su und wen 126 P» eau ch y« y t 116 si dnt ith oui y • 125 e u goi 115 do 124 g122 n h 121 ays m. 120 dy o. th 119 ame »g 118 ft g » i w ove 117 oh rs 117 (conL] 114 any cou «y uld 113 s w 112 s h 111 ta w. 110 bec i d r s 109 art e f hem 1t ste way 493 TABLES O F T R I G R A M S 108 fir aus oes yd 107 da eca kin ook 106 at . n ah d u 98 ro i h o g ree 97 bi au ce 0 s oh say t b CTS 96 fa ki ti ck e r n w ng. o i 104 tw ach ow. 103 lo ant d m ime m t 95 us eac 94 se 102 su him not y f 101 P» o h 100 s b t y tim y m 99 br can h t s u thr om t u 93 or . u che e1 itt m a ugh w t 92 es. ist r h wit 91 ead met n s 91 (conL) 81 i 1 res tg 1. t m 90 est rou 80 g" na tr ake ear ty 88 ri own see 87 em lay oun y h 86 . d h a hou it. mes o y tie 85 le pu s1 wor 84 ne ov at. tch too 83 . b eal sed tea 82 la ah. ate o a 79 pe al ss us ven 78 k. mis o b old ry s m t d 77 . m how ny 76 are dow e e m w no re. 75 gu ack h i s y t1 wn 74 e n o m 0 w (com.) (conL) (COIIL) (cant 74 67 (COOL) ous r b tho ttl ath lit u c ran s c s p 73 a b 72 gr h re • g idn les min ood ose r w 71 ch if if ill ish m i s r te two 70 com ds rt 69 bro i t n m r i 68 P* d b oug t k tar ten y g 67 a1 66 n y nam s f y ' 65 de a s aid aid dy g o inn n o 64 be sai y b 63 1 i Uy roo tin y c 62 big doe ok ool sho t f w a w w wat yth 61 ink mot ork 60 a c 1a 60 wo 59 ate eth gs guy iss k a las Ue ted 58 ast ick 57 cl fro has hoo U me. o d r m rie 56 im po a t ain ayind s n sch 55 ot ar eat een ew ns t n 54 bac car cho ean 54 ess •g nk rig snt y o 53 ea alk de lin put rd sh t e tak 52 fe ni 1w man mea 0 0 P « r f 51 sp d g e k ets fiv ide ion ort wan 50 d e hea ir m s mil ne. ngs od on. P t pie r o 50 49 ga bal d f fat h m let nce 0 u oom rot t c 48 as der end hed ore par rin tte ure wou 47 cal cat e j fis gra ite m h mar off per rk rom tal u s w h w i 46 a p g i i s no. 45 by ett goo 44 af un ari fte h o i m n u pen sto 43 a w ace eek Idn u g 42 dr P« wr ark cha ff fir gir han ied irl uy y u 41 aro d1 goe h w har k i ody r d sis wee yin 40 ex ra 40 37 34 31 29 a d alw fy f. 1o lwa nde ock ope rit s d tee tel tes tic who 1 S loo lot oli ong g rst ryt tur y p ol ade d c d d f h fou hos irs nés nts sti Pr e r1 r P tri uch win y e op r u rid sha sit spe w s yi 30 iv . f des eir hei ht. kes lac led If Ion m g m u n p nd. nds nte pos pro ron top ts. upp 28 ac el (conL) (conL) (conL) (conL) (coni 39 h y hel ked lan nin ol ost 38 bod chi d p fi h h mon t P t r yre 37 en hu aft ars boy ese eyr fri g b g« hai i k ien k t 36 ke . e a f a h bab ble dad eet en. giv h u i c k o le. les 11. m o n f o c se. yes 35 ei air din ice int 1h nly onl stu sus u h ves 34 ag bl cr 33 boo gh h b ins lea r c r y ssu tio tor u w 32 mu ati ber col eas eig eti h s 1u lk nyt r n rac ren 31 by a m dog is. mov n e nev nt. 01 o p 29 aw cu jo als ass awa em. foo ger ies im. irt i y Hi n b nig ond fl ano aug con dre ect eep ept in. n d nth one 00 ou. red rte rty s j shi tro u a u. ybo 27 -g a r fa i u 1b mad ms n g new nge oot P« sin str twe 484 27 FIFTH GRADE 25 23 (con t.) (cont.) (cont.) UTS ns. o e lis m f m m mp nty oke por ppo rs. st. ump ute w o won y n 26 ey fu sm a g alf ape ask cam den eop eye g w gh hir hro 1m m b m y n c opl peo ppe PS rse s e sur vin yy 25 sw ve amp ang bee ce. cke ens esn et. fee ic kid lar mak •nos nny P ' rai rks row tti u 1 24 bot bre ch. ds. ext gl gav h f hol île liv Ils mer ned ons ors ot. oup r r rop rts ryb son sor tan tra u d u t w y 23 ce ayi clo die egg ele gh. hic • j ich itc 22 ja qu .1 a. act ago an. ase aye cla ed. ee. ek. ep eri f s gre ho i a i f ica ift nch 0 f om oo. pe poo rew sid six ull une usi ut. whi 21 . c abl am aw cks d j era fin gf g u hil hom hur ie k h k w ld. low m d mit nex oh. oss P o pie sev sup torn try ues xt 20 op ash cle d n ero ff. fif gin gro h1 hai hap hy ' P ily isn 1er llo m 1 mbe 20 (cont.) mom mor rda rie rk. ris sic swi toi tud ve. 19 ad eg sk tu aga app era cti d r e v enc ene gai hor hun ids ire ken kit lki lia nis nto ol. ona ott pap rob san sen ton ual um. unt urt wal why wri ys. 18 a a ami ck. die dol ece emb eme exc fun ge hot i i ian inu ix jum k y kee 1c m p med oda oks oon ord pin pre raw rd. rds ret rri tba tod u m ubb up. upl y j 17 aby ad. ane bas ces cky cre eco f f h g hit 17 16 15 14 13 12 11 10 10 (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont) (cont.) (cont.) ilk g y ham id. idd ini îrd ita ks. loc mal nni nti nut ovi oys pel pic pul m roc ros rt. h p il ise k s 1n 1 r los lso lymem mic mid oat org om pan pee rad rat sat saw ses sum u e urf w m ws xce yar gd g e gsh d hme lec ley lub m j mmi n n nal nat ndf net ney o n opp ouc ows ph pra pri que mi sec sio sse sty tat thm twi uck vis g c gue hs ial imm k m 1f lat m n mas mig mou mps n r nee nic nor oba oni oor ots pou rsd sel tev tty udi ved vie w c wro y k yer fra atu avi bra cid ded do. doi eba eni ert eyd eyl sea ser sne sun tie tiv tiy u r us. utt w d wic wre 1g 1 1 lev ndr od. oie oy ped rec rem riv rl rth s k sda ske sma ss. ssi sua sub t j tai thu til ufT unn usu uys w b wil y r 16 ae am sn P acr ads ady ail apa bea bes bri dea dra dri efo fam SCO sh. spo stl te. th. tre umm urn wed wim yed yon 15 ai lu ya arr asn bet cep cro earn ebr el els erd f m g m 14 je a n a u acc adi aki am. ans am bad bbe bef bla bly boa cut ddl eng em f w fac 'P iti ky 1 d mme muc n j nda ngl nit o r og owe ris roa ryi sk ski tam tay ths tuf ty. u p ung usa uts ye 13 du vi a y anc ary bio dge dis err f b f o fig heb ier inc ivi kne 12 ru ait ams ato bel bir cia cki cor ct dfa dro ea eci eck ek enn fp fer fre fty 11 ah ap gl si . r a i age al. arl bar bed cen cie dan eit ete few g «• gar gg gol gon h c h e hig iff k u ke. kep Is. Ise na ngi o k oad of. ogois ori ote pal pet ppi ps. rgo sal sci seb sle u b ud uit war wn. yd yei 10 es id va add ae. ael air ar. arm att g P gla h r hae hte ict ida ign ild ina itu jap jec k b lee Iks Ire m c mb men mus nci nst nus ny. nyo oma omi p w qui ra ram rio me rok rre rti run ryscr 9 ed ze • j alt arh b. bit bje bus by. cer du coo cto ctu de. die div dmo dy. eed ecz eks eno erm esi evi ewo f1 fal fel fib gam gge ggs gl' go. 495 T A B L E S OF T R I G R A M S 8 9 8 7 7 (cont.) (cont.) (cont.) (cont.) ( c o n t ) hip hum i r ia iou k r ket lau leg lim lip lun mat mew mpi nel ndm ner nta oft oms orr otb oud P c rV rha ril riz rm rpo sam set so. sof swe sy uu ub ubj ubi un w u wai woo 8 au il abs ahe alo ani aw. bat bbl bby bse bub bun buy cot cri ddr ees eft ein elf emi ems epo exp fai fle flu ft ftil g n gto hee hts hua ie. iec job kil 1 j lai lef lem If. lie It lue lve may mpe nk n 1 ngt nne noo oci ok. oki oli oof orm ory oy. pb pec poi ppy r k rep ria rip rly m. rno sig sou td to. tou ui udy uh. umb ups uri uy. wis yll yu 7 em oc ok oo a k a q adi afr agg aim ann ara as. aud aun ban bik bil bli bon box cas cee ein coi cub cus dec dif doc doo dry eak ebo eel eer egs eli elo elp elt elv ew. eze f c f d f r f u far (Te g g geges hik huh >g ir. isi izo k d kay kel lad lak Ids lib Imo lor m e m r mac ndi nea nei nou nsw nyw oar obi oct ode oka onn or. ori owi p r P s P u pup py rag ras ray rfa rke rid rma rso shu ta no U 0 uni urd ush uss vor yti ze zon 6 ee mc nu vo yu a e ae ak aid 6 6 5 5 5 (cont) (cont.) (coni.) (cont.) (conL) ali ank atz avo b i b o bor lov lt. meb mei nia nie nk. nki o j obb odg ogr ogs oye 1k U lam lyn mau ms. mse mys na. ndy nhi nif nos nve ob oky omb op. ops ore ouv uar uth uve val vee w1 wea wet wli c. cco di cur d V ddy dee dir dly dur dys e q edd eon eps exa ey. fas fav ffi fie fit ghe gle i 0 ibi ic. i et igg il. imp inn ips isc k c k f kat kle 1e lde Idi len lie Ike lou Pf pai pam T j rgi rib ro rod rog rol roy rro rry rta rtz scu soc tit tow tsi tzo u f ubs ude ula urr vel w e w p wav wes wo. worn xpl yet 5 ci OW . k abb abi adr aig aie arg arp aso asy atd awl ayb ayg be. bos c t cap coi cil et. d k dig dod edi eem enh ere esk fg fbo fla fol ged gg> ghi gun hie hob hov hri hs. hut ibr ili imb ims ixt ize joi ker P 1 pat pay pépia pop pot pus rar rch rde rdi ref rei rfb rge rto ryo sep sna sno spi SSO sts suc tab tep tli tru tt. u y X t X. ybe ygr yn ywa 4 ay ka ph a j a o abe acá ado ag ahu aia ais alb ana ap apr aps arv asi aum avy aws b a bau bei beu bie bom bov bui bum cag cdo chr chu 4 4 4 4 3 (cont.) (cont.) (cont.) (cont.) (cont. chw cio cop cte ctr cy eye dar deb dia dne dus eag edn ege egr el. eia eld esd eta etc eul eut ewi eytf f e fie fli fly fur gat gn gua gui gus h k h n he. hec hih hop hti hwa hy. i b iah idi ifo ihu ils ino iny ip. ipp irg irp isa iso ium iza jay joe joh jud key kic ky. 1P lah law Iba Ico lif liz lop med mee meo muí nai neu noe nsi nyb ocl oe oge ohn olf o'lm olo oís oop OOS orp os osi oub ox pas pes pit plu ra. rei rev rki rov rtl rub rum rve rvi s z sar sem sme smi soo spa swa sy. tV tac tern thy tis toe tog tut tz un ua uah ub. uda ue ue. uil unk ur. urv utr vac vie vir vol w f wev wid Xm X 0 ycl yeyno yos yst zar zer 3 et hy i. oa ty adw agu ale ama amo awe awh ayn b d b y beg beh bs bst bur c b e o ca cab cca cem cet chs eis ckl ckn coa ctl cup dah ddi deg dev dio dit duc dwa ebb eda edg edo edr edy eff ehi eim emp ena env epe epp erf erg eri erw esp etu ety ex ez n f k f n fea ffl flo gay gor gos h j hak hda ho. hoe hty hyd hys i n i. ia. icy idg iel iev ife ifi igu iin imi iod ipl isy itd FIFTH GRADE 496 3 3 3 2 2 2 2 2 2 (cont.) (COOL) (coot.) (conL) (cont.) (cont.) (cont.) (cont.) (cont.) ito psi uly bin jef pte une je* J« jul pub qua uns unu blu bma epa equ esh boi bs. etw eur bu evo kg k 1 keg Ick llii kna kyo Ibi HT lia 1>K lk. lib lo lp lp, Ite lue lum lyi m k mag n v nag nap nkl nle nob ntl nur oak ral rap ura rce buc exe ixe ngu wei wns c a c h eyo jac jam nim rga rgu rif x a c 1 xac c P c r c s cav rle Hf rm. rmi rms rpe rtm s V sea sil siv siz sks sli spi ssl stc stm stw ta. tee tgu thd xag xes yda ydr yU yse ysi z. zed zo zy 2 eu hm 'y sq sy ur wy a v ab aba adj adu aff ola orno tma tme aks ala aly oph ora osfc toi tok toy anu apt art) ot| oti tst tub asl atr owb ox. typ ayl azy P«• pb r iva ix. ndu nee nfe ngr reg rf tia tif tir P T isl itn ncy ndb usy vil obo oil P* PM iot ipe » j uba ugu uie uin ule b s b t ba bbi bia cea eel chd cip ckb cru cts cul d q d z da dac dam dau dav dbo dde del dep dfi dju dop dot dru dub eau eav fe fe. fee «y « fos fth gas gea gen geo gg ghb gU gic git gne goa gry gur h q ha. jel uma ume rli rna ms ro. rpi niu nix rra un. uni uoi uro urp use uti noi nsh rus rwi nsu ntw ryd sel k j k n 0 v oan k P kba ki ob. obs seq shm sie sir ska vid vou vy vy. w g w r sla W slo sni squ ssy sud sue w z wag wba wif wiv wow sui tap taw tax wy oce kip koh kya lab lag lap Ibo odl oha Idf Idr opt hdo hez hib hmm lo. lus hon hue lut lyu ma • y iam ul. jet joa jok jun Idy lid lio lix lm. hbo ri riu rky rl. oia oko onf ono onv oru osp ota oxe oyd oze tea tet til pd p T1 paw tne toa tso phi pil tt ttr pio pip pol pox tts tuc tue tun pti pur tys tz. pyquo uag ubm ucy ud. udd van vat veg V x s x w xch xer xpe xte xth 1 1 1 1 1 1 (cont.) (cont.) (cont.) (cont) (cont.) cy er f bak bam gh ic ben bev \>g ir bib j' 11 mm od oy bi bic bip bob bow bud py ug yv bye bys c f zu aas aci acq acu c i cce ccr ced chh ada adn chl chm cht chy cif cir aes afe agi agi agr ags aha aii aim akf amb amn cit ckg dom foi hns dou doz fru ft. fud hoc k e k k hsh hth lea. lean kfa kgr dst dua dul dum fus hup fy fy hus i e dut dve g j gad dyi a. gee gem • q iag iar eap ebe gey ebu edl eds edu ef efe eg eho eil elc emo enj enl eo cni eor CO eph epl cof cok cos cov cow epu erh erk ggy gha gho ghs g«e g» gio glu giy gn. gna gnm gns gob gop gri gum gup gut gy h v haa hab icu ido ief ifl ifu ige iia iki ilm ilr inj iol ios ipa ipt iqu ire irm iro isd isg isk ism y v yeo yle yo ase ata eta cud erp esc eso etr eum atl auk da. dab eva ews yok yor aur aut dai dal ype ypl yro awn ax axp das daw eyb eyn eyv ywh z a z s axt ayo dd dds dew ezm fak hi hla jed ayr azz dfu dim fed fen hmi hmo jen zee xtr xty apare arf cqu cry hac hag hah haw hax iat ib ma. mai mb. g 45 lot tak opl u g as la peo up wan • P pro ee sn yd tf log y» ri ted 50 t 1 39 eyr wou g > y g g" um ind 44 an ow thr is kid und n w n h yre ous n o say oae 49 sb a1 43 w t ine gr 38 she a s bee ar 48 o d on. o s ook at tk> ork gu mi yth tin ri »j 42 t g ds mor cl tim ree ays ven ss dnt 37 too f i i1 fa 47 ol ati ood che Pi ate » g etc er t U got hw hy ime 41 k. pU ti lea ut d h muc ngs u w es. per fy 46 hoi r w mu i y »y ame men te two d u rig e u sti im y o 36 iv las nee ni 27 25 22 36 33 29 (cool (coot) (cool) (coot) (coot) ac a b wo ed. ked y 1 ace min ang ach gs 24 bac day 32 guy nip han ody d ett ast de ick oL dow h h ect ot lin end liv s d ph ead m t fro nev tee ack gra me. k a r h um. car hal s m y b d f hy pre lit eas km sf oh t r s h tal 26 eri lie tur um u 1 urs •g ese n f w a id ns u. yf gy hil ord y c wn «P 35 y P aid ho« ran mis rat ass 31 ce. 28 e j nly ses Me da chi ex eek o c six P* ht. eme a c pu «• P ss. ard un hum red ttl ic anc ien rs. uy who dy hie aro 1 0 s p w m 34 i k why d p n m tic m a der »eg u s dT 21 ou. egr ok ain 23 ad alk p«y h o rom fu br goo ren hre rt gro s 1 ica na bli rty ki s r ide s c PO cam dd kt stu idn s u ali eke f a 1 a syc Ian snt f. °gy w w man y y dis old e k giv y n oes ych ope 25 ge hm Pt ort sur app gin ice cU gre is. 30 ost tP 1 w u d bl own col 11. rf con loo lif whi en rie d 1 n b Iwa jo 33 ov rse d m n e ned bi eat sho din nds o 0 dri fe nes ole Ug tar onl con itt fer nt try ite nta r y g0 ns r o san ks on 27 les ra mos ret tra mes rd od tes us ay- n d ryt sin bod ne. t e vin tte 00 ten y e tn y n> cal tea ck pen tie yin tel 29 i i rob uni wee a t ids sai 20 ae ag am ade bet dn ee. ele fun hea hro ivi 1 m •y nge oU orm r b rc r1 se sio son ue 19 ce ei 11 ol .m aw act alw ber fin fte ful ho ich Ik Ion nd. nde no. nto nyt ou put rst sh sse twe 17 15 19 16 (cool) (COOL) (COOL) (COOL ues uh. unt wat 18 af qu ro sw eks fir fou fri gb g1 hei hop «j ir ko 1d If mg n 1 nig oe of off sed sel St. tor 17 sm .r a r aki ans ath by ct ev en. ets exp gw ger gir hu hap ies irl in 1 s Is mi med ng obi ong ons rd rm rk sat sem SOT t j sec tat ts. tti ua usi y " ybo 15 ea ga ty •g .1 ad ah a. age 16 bef by big ke cee dc .e abl dep aft doi ar. eco ces eel cba eep cul efo de «g ded em. eir enc eli fc fee S hb he ish ife job ins ken iol kee lg 1 h lar lac le. lor lis mA m h mar mbe mat mer may mon mil ms np op ond rda or. rem sc. pe pin spe tan tch ton tri typ um ula yr ysi 14 es us ari ash ate atu bal den doe eci elf eft ew Be gf g» hit inc iti ity ixt 1b lp 1u Idn let lli loc lov ms mem ner nk. nts nty 00. phy rn rad ro sV ADULT 502 14 13 12 11 10 (cont.) (cont.) (cont. (cont.) (cont.) sit sto Str tre u j urf us. ut. vel w h w y yes 13 cr il a a am ayb bab bit ch. cia clu d g eet enj ep era ext f s fic g c gue h d h f ham huh iff in. isc joy Ices los nic nio nit njo nut o k o 1 orí Oti P « ppe raj ríe riv rte rti ssi swi til tol tty uit urd ves wim won ybe 12 ago air ami amp bas ctu d r dif do. edi eem elo f f f 0 hg har hys iat ild ior lig mal nam nex nti ock od. oup ppos r e rde rki rn rysen sou tru u b ual ul w b xpe xt 11 ap ey • j P a r a n acc adv ae. ane ano ary ase att cat clo ddi des die ea ciub ems eng eni epe ete eti eye f h g P g y gam go. g* gyh 1 h n him i r ial •g ile im. isn ize ket 11 lay leg low Ive m w n u nal nee nst ogi ris me ryb sha sid so. sup te. tua uat urb ute uth ved w s wil y k 10 aw P> . c aga ape ark as. ask b. bad cie ere d j dea el els emo esi esn f w fel g m gen ges has hed hon icu isi Ics. Ike lou mot mov n c n j new nny nyw oot org orn ors oy pas PS r g ron rso rue scu shi sig smo ta tud u p ue. uff un upl upp wal war win 9 9 (cont.) am o r cu OCT du oni ae oom ajo oor ani orr ato awa ory ouv bje ped bio pho boa bon ppy bor py qui boy rec die ds. "S eed rge rim ein rke ene roe ens row epa rri era rta et. ser fe sfe fra soc fre sue gh sum gai swe ghi n tai tme ici ied to. ign ty umm inn unn iss ix uve w c jec jor w d 1f wea 1n wis 1 r yer ywa Ut law ze lec 8 maj mme op n r yu . f ngi nne a v alf non nsf an. nth aye o n Wy 8 8 (cont.) (cont boo bri bus cit cs cti cts d k dec dol eav eba ege dp ept eta exc f d f m far fie fif fly gd h r i a ics ilt inu k w Id. 11a llo Is. lub mmi mog mul nch ncl ndi ny. oba one orl ot. owe P« phi ppo Pt pus rac rel rid riz rid rma rtm ryi sea seb spa spo sub t v twi u n u r ude udy unc ung uys w o w u xty yed ypi yu 7 ai nu zo a o a y adu ail al. als arm avi aw bed beg buy cco ced cis ck. cor era ct. 7 7 (cont.) (cont.) Cto cus def del dge doo dua due dy. eg« eit ela eld ely eyv f P fac fes ff. g u geo gic gn gua h c h k hel ia idd iel ifo ift ige ili ima imm ise k1 ke. len liz lis lto m b m o mag mus n n net nks nni nor ns. nse ntr ob ob. og ois omi ona ows pan pay pe. poo por qua que r r rbe rbo rds rks rl rls rly rmu rni roo rot rov rry rth rts sev sic sk sla sy tie tiv tuf ubj ud up. vee w1 wai ws yr* yve zoo 6 ah au em oc ru si wr a i add agi apa aso asy ayi bel bro cid cio coc dit dod dva dve ece eor erf err f1 Bi fiv g e g r gegon he. hia hip hus i. ¡an ic ict imp ina g ila imp iny iod ips ir. ire irk irs isk isy itd iti ium ker key ky. lam lat Ico Ids Ige lip lit lk. los lty lug lum lus lve mas mi. mix mom mor mos mpe mps ms. mud nas naw ncy nda nde ndy ney nga ni. nne nue ods ogs oil olf ols omy oon oot op. orb OS. ote oup owd pal pea pes phy pig pit pt. pts pus ra. rag rah ram ray ree rgy ria rms rna rog ron rps rta rue rug set sis sit sly sor SOS ssy sta ste sy. tan Ur ti. tin til tte tub tys uam uce ud. uge uit uls uni uns urn urt usk val vey vie wed wet 535 8.9 TABLES OF TRIPHONES 8.9.1 First Grade * In theae table* a caret ( A ) indicate« a tpace: Note that diphthong* are indicated by two synbols to that there may be four symbols in the triphone tables. Tables of Triphones First Grade 424 .aeri 340 •m. 319 wen 252 .en 249 -W 248 ebe 247 ber 246 -ay 190 ?em 189 r.. 184 ter 183 sem 176 .may 173 ..a» 167 wcn 164 er. 140 m.. 139 .em 134 ..? 130 nbe s.. 129 -b 125 d.. 124 -wiy 122 -y 232 t.. 221 .we 214 ben 206 -?e 205 Z204 wez 191 n.. 163 ste 160 iy.. 155 .hiy nb£ 151 taym 142 . wE 141 ..e 119 layk en. 118 wer 117 .bc haev 114 ..h 113 and 111 er. 110 ber 108 ene 107 enb 103 aenb 102 .be pl£y 100 haed 95 .be 94 nwiy 93 £n. ent 92 Oiq bis bae? 91 tywe 90 erd ?aen 89 ens 87 ..m ow.. ver 86 del erz 73 _yuw big grae baet ayhae 64 56 aede -bey ..b hiyr uw.. 62 g at enn 72 61 .bae down fer for .se mtay -?ae kem zen est ayke Eybiy lyhae 83 meb 82 ..s maym 80 ide 79 71 ist wiyw 60 ¿en. nd. ren 70 9« e.. ayme inb its 1.. nne ?we yen eze 77 howm kez 76 ..n 74 aymz 54 -y£ Enw fre owve ayga -Jiy ine emt eniy tse ere Ey.. enw aen? bre ers Enay m.w n£ym .now may. now. 78 ..i Qteg we? em. 59 69 55 -£n ga? ir). bet erg aenn tyst 49 daed Eniy mayf nhiy her mmay nte rawn wim wiyh amp ern aeni 45 Ent in. now. 44 nwe w£l n£n raem 48 wet erw kin erne «ve ?en ken ksn end enow den 57 ber End min ner enay ez. der 50 46 nde nnay -ye mayb 65 sen erh be. eli eft aenay aywe .sow en. egow .?ay haws sis skuw bfyb io sik did dawn 53 din 51 be? it. 58 66 art 47 .tuw one erk 68 67 52 (cont.) reb ebaw 538 52 .in k.. Iid rem swi wi6 zin m.b tem yer eri et. «ne aets nye ren swe el. ?e. 43 -it ..ow fte n.c nn£ aydow 42 iks owwe tes beb enh lyga 41 -ke .ayh ..d 39 (cont.) aybr 38 -ayd .ayw Eve fr£ inn l?W 1er £nn [as mayd n.e nmay nam ben Orty egt bes enz erb ekl ezi iyw£ 40 -ayg n?e per rwe riyl tar 37 miy. n/iy ike nayg kte no w w nen owld ven wiyg bem 39 .?£ ade n.? twe emay 36 bet Enb 9£? imi n.b nit nts ntuw tep bew SEd wiyk e.e ede z.e erb epl TABLES OF TRIPHONES 35 .ta -Wl at« En? Erz mayg tcyk s 34 .ayl -aym aòe baw? diy. int mays nsa r.e sta ted eke aenw aydi 33 baak daz £ks cr. £vr fa6 g- haef mar n.w r.e z.e a-? a?. ayde ly.w lydi 32 .bi ..t gowt in. kEym kuwl m.h nat niy. 32 30 27 25 (conL) (conL) (cont.) (conL) rz. raen t.? aka ewEy aediy ayda aylay 31 -g ..k bik bad dam das EL Er. hiyw Ian m.a man men ndiy na. rayd ts. tan yuwn el. alz eng erm ets ?En 30 diQ deb Eni gan m.ay nayw teb tiyn 6ek abi e be at. e?e aygE aygr 23 .Or ?.. rse .ay. art bEd ?ts te. gEd mam ben vny 29 z.? n.s dag .di zeb nyuw dev ear .fa niy. Ere ehe a? ins Pbawt emm r h e i?t fayv ems no kse gowz emO rte kud howl emiy stEy miyn saen (am enm nin klow eny tel nst mir) wEr tyze neg mayn lyen /lyz nek nhae uwnow alb ne& r.? nas 6ef 26 r&a abe rz. tsw api nyt -g£ am h .ayk aym. sin aysi sky ep. -J ask biyz Eywe t6e lygow ude aykt d£y. Ed. ?.e wud tyke Ets ?may yce 28 fen bap 24 f.. gad ediy hiyz it. .gow enl koz .he eny ksi m.m luk en? .ays m.? ..f eri nz. nayk mBi ..0 awe ownl miy. aks aens rze miye at. awt. tuw. nz. ded Eymi neb iy.? wed Ete pen hiz wiy. 22 ruwm hiyk ate aynow t u w . .Ev ind iijk aywE zte -hi .er lyda ars ize lyz. emi ker ard Eny ent ket 27 e?. I6e fU awn. n.ay gowi da. aypl kar dep nat gen owm. ks. ly.e zer gar lyz. m.c haez arn mzay 25 &Eyw mayt kel .an n&Ey enE ni? -6i erf rde nays 19 22 20 (coni.) (conL) (conL) n?. sayd tel ta6 yuws òed &eh adi ada eia ani ave «ma aenm awn. ay. m Ene ini is. i?. kiq kit kayn laes liYmhow mayk ndEy nlay nliy nm ntay niys owniy own? owte s.a ske sow. til tst teh tuwe waC wak wiys znEy ztuw &Eyk emb ama enö enk es. esiy evò e?w aemp awte ayk. Eyke lyrz lysE ?.? ?te dit deg diy. grty gz har keb l.e lEys min nd. ndi nEv niq nel pel r.h rdiy rst t.e t.e tin tny tak Jiyw zmay ar. ebEy ehe epe eraw eray erEy ez. ed. ens aet. aws. aws. awt. aygow ayma aysa 21 .e. .ayn .?i d.e dag Ede inh IQZ ita iz. Iiv m be mz. n.h nEk rtiy slay Stl tuwb wiyd z.w &iyz e.w egr etay aesk ayfa uw&e 20 -de .fa .ka .lay 19 .eb £ygz lytay 18 .he -Je ats b.. Ee. 539 18 (conL) 17 (conL) IES lowz im. Iz. itw mal lev maye mfr nsay mows n t mem nan mcyk nòe n.m new ngE nayn nniy owst neh owwiy pin nay. naym pta paen ri h r.w rad rayt ny. riy. saz tap s.? SEV tsi tew ski soww ann eday ts. ••1 tak esw tat tuwm eye aw?& vam ayd. Jiyg yuwk ayje ayke zfte ayne e.& eduw lybe elb lyte ?.w emz ere ?&e aema 17 eze .way awde ..r awnd bil ayli Car aymg d.w Eyhe di? Eyks dayd Eywi ly.e de gowd tyke lype ig lyr. izm ?in kid ks. ?òe kst gEs ig- 16 .me .miy .na .pu .ray .asm -?OW biyk Enz Eri f£l hiy. ige iliy iniy ise kaet kuwe Id. Ide m.d msk m«i mer mayh na? nis nep nayt owmf pud pan r.s rhaw rmay mi rtuw rum riys siz str stuw swiy te? z.h zwe art e.k e.s ebiy ed. eda eka 540 F I R S T G R A D E 16 15 14 14 13 13 12 12 il 11 10 10 (coat) (conL) (conL) (conL) (conL) (corn.) (conL) (COÇL) (cont.) (cont.) (cont.) (cont.) M l skw dey. trty ed. •maw lad anp etr SL ediy tan edi anf lin an/ 8W3 stiy £mm v6a en; ayuw Iz. ana flay git gud ayfr aiy tnh wiyz eriy azw Iiys apt aymay ten Evi /iyd fya aza m.g atey ayn. taf fai yuwr fayn azay mar atuw ayt tuw6 gow. z.s gin abi mad awiy ayyuw uki hed Zlt goww aniy maw6 azt eyki vin htyd old h an ast meyd a?6 diyw eft Erw fiyt g raw geym idiy ifr ikow ina ini isd ivz iwa izd in ken kil kla kra kwa ked kiyp lat lif III Ian ras riyw s.s show sid snow sowm spa St. ityg Z.& ly.h vak isb an6 hiys aTt n-J ak. lytn win isw Omay IQt ayst ngow anb lyna IZl 6a? is. ayOi nmiy ank lyr. Jiyyuwz i8m adey i?a ay a n ns. at. tyve zal k.a aga Jim Cydiy nti aw?t lyam zap kal ahaw k.a eym. naf ay.a ?a. ant ka? ala let ly.m myb ay.. ?iys a.. Iak •nb mpi lyliy owda ayku 60WZ lowv an6 mwe ?tuw owm. ay?. 6ag Iak ap. nka Qin ay?a -fay abc lag arp nli r.6 eyda .ha amw leyi ass nowh .biy riz iy.s .«h avi l£yw asa n6i .dow rkl lybr .?3 awa awi nad lyge azm a?ay ow.w -gr .hw rney ..a iiym.b riyd lysa amiy ez6 mz. anh ow.6 -huw s.a iywey arti aev. muwv atò piO .ow. sez uwst a7t a?w ndr a?b puwl -St sriy ?.ay est aw?. niz ay.ay r.b -siy sar ?gow gows aykft nnow ay.? rsi .at tlQ ?t. hiyg aymiy nsow aym. ran braw tsay ?ap ima lyt nftiy aywa sta bak tuwb iQi iije uwl. nav lyn. s6a bas vit uwal nayh iyaò sab d.? vab .own iz. ?bi niyv iy?. sal dan wayd .ak k b ?e? niyw ?-6 sap d6a wiyp .8V n?t ?ha tta diyz /uwz tuk ebr yuw. -I a.. aka 15 kn 1.« 14 ownn 13 12 11 Iak .fr owzt t6e en. z.b leyd .ga p.a .de tiye enm af. apa liyp .haw put .iz wan epa aki arh m.s .kl piyp .si wiz esw alw biy. miz .ka rdi .at gowa ala d.s mayl .nay red -ayy i Jiyh him ara d.a nu .se rks ala yag han Sin den ndz .31 riym bit zas hiyh 6al dta nney -6iy .ayp s.w dal ar. id. 9-1 dz. nowb sda deb ata idi aba dak ow.a ..1 soway dis 6eyh 'iny af. dat owtq ar. ste dra 6iya in? agi els Qka bla t.ò dar a.a aki esa rab bal ter deyw a.ay i/. ksd als et riya dif tmay duw. abay l.b alt e?. tiyv v.. viz wi& g*geyv wiyr her yea yak hit hat ytyr iqp yuwg ism zhaw zan iti klay zam kas aka l.w awiy 1.? 6ey. a.h Idi lef ama br anr laym ar? leyt azh m.y a6i a?m mis m pa adt amm map may? a n j nar ate ner a?s nha ayown ayan nij "n8i aye& nan eymd nayd lyfie lydow nayl niyh iyja n?n lyn. owme ?.m ownh 10 owz. .ar rd. -br rfr .sk rgr .a? rga .ayow reyd reyt .aye riyb a?. sen bak sow6 bri t.b bag tit biyf tmiy biya tsn d.6 tayn diz m.f mba mga mowv msi mza n.f nde nhi nowi nowe nsi nsiy niyk niyt owsw ow6e pig rba rga rgow rme rsk red SWC sas t.s tbi thow tsk tiy£ tuwg ver VII) wat wan wey. /iyk iiyl yes yuwd Z.l zde zis agz alt alow Odey &em 6eys e.d ebr ed. efl eh. ehow eha el a eia elay ere erO ese ata ata etiy TABLES OF TRIPHONES 541 10 9 9 9 8 8 8 8 8 7 7 7 (conL) (cont.) (COIIL) (conL) (conL) (conL) (conL) (conL) (conL) (conL) (conL) (conL) szb azd azz a?. akt amay any ath a?d dmay dwa dya dyuw dal dew da? dat d£yz diyp duwi £ns ftiy fawn haw ift ik. tld imm inp iQd iQO zowl zsa zal z&a za. zag zayw ak. al. aró 0-« ar? r.k a.b r.ay rba a.p rd£y ab. afr nt rlz afa rmi akr ral alw r&£ am£ emow ral ama ras rak ap& r£yb atft rtyn •way riyn azr azs s.6 skr ala sowiy a s a ayduw ssa stay ayks aymy ssa sak ayt. siya fyba t.m £ydi tik tyki lyku ta trae typl tsh lyviy tsm uwka uwl. twiy tar uwli tuwt uwzt wiyl ?how /iys ?ka ya. ?al ?an yap z.t ?al zga ?ayd zha 8 zhiy .b£y Z1Z zlay af rsw rwa rwiy rar rav s.b sbi sdfy scp Slt Sil smay sowh stw s£y. t.f t-W t.ay thi tha tsb t&a tav tuwh udi uds ukt um. v£n vad w£w WlJ wad wal wam was wfy. wiyt yuwm z.f z.m zgow zhow Zl? zny zad zak zaz zawt zayg z?a oda ard awi azay 6row 6wa Oawt 6a0 a.f abl afi afa aha eje ak£y el£y aliy amf amk am? enj apu ara ar; as. asn at£ av. azg azn adt an. ape avi avt awna awn? ay.b ay.w ayd. ayki aykEy aymn ayms ayn. ayte £yk. £ymb £yma £ys. £yt. tyvi ty.b iy-f iyfay lyiz tyks lysk lysa lywu tyfli uwbr uwg£ uwgow uwh* ?.s ?it ?W£ dak dha dtuw dza daf daf dah dawt dfyay diyd diyg duw. d?a £lft £rm ftf friy fam fiyl gar giv gow. gowh gow& gny gwa hm. ha. ham hap hiyf hiya htya igb igow im. inw ina irjb irjm 100 IOS isf kat k&e kai «?m awnt ay.6 ayfa aynd aywD Eyin Eymz £yta ly.k lyfa iyl£ lymEy 103 lypi IS1 isk lypa lysi iss izf lyal izh iy6a iy?e l?3 uwmay kmay UWW8 kra ?.b kwi ?.h lit lows ?sa ?wiy Iwe ?ab lab ?£yt layn mu o 7 m.p maz .da m£k .day .kíy mma .n» mst mas -Pl .•1 miyi n.b -P n.n amy arz n.t at. nfia bríy nma nsw biy. nal t.. na? nayp niyfl ow.m owhaw owmw owmay owtuw OWWl .kr -l£ -ll -riy .wa .ayfl -?8 -?iy aCt ah. arm ban bal bayk bay. Caz d.h d.m d.t dda dsow day daft daya diyf k£p kt? kli kla kowl kray kny k6i kap l.i Idaw l£V lik liz Imay lam liyd m.a mpa mwiy maz n.d n.k n.y nda nowv £.. £lf nsp £rb nt. nwi £t. £0. niyd niyp £?a gowa niyO n?w hap har ow.b hwf ow.? owin ha? hawm ownt h£yr owza huwz owan idn ow6a id£y p.a par ify inz pul itd qga itm rbi rbr itay rd. i/rdz izt iz6 rga i8. rki lOi rl. rs£ 1er ?®y- ?ayh 7 .duw .fi .mi .me .n£ .ra -5W .aw .af .ayb -ayf «yl -ayt .aya .?£y alow ans ana apara a?d a?w b£r bin bliy bar bam bay bty£ biys íik C£yn d.ay i/i izn izs izz iBw lOa i&a kla ksm owz. owat ptn kwn Pn par kae l.m 0-a l.s Opuw Ibr r.i Isa r.t Iwi rda r£s las lay? rfa ab i«yIfyk ría l£ya rnd liyg rs. m.k rzow m.n ra. ma. r?a r?iy mta mwi s.h mzh »-/ sma mag ma? sma mawn smiy miyt sna n.£ sowl nba 8P£ nbr sst ndm sta ndow sway ndaw sal nday sa. nduw t.t nfr tda mk tfay nim tray nka tsiy nowm twc nray tuwd nt£ tuwn ntr tuws w£e ntiy nay? wir ntyz wayt ntya weyk n?g wEya ow.ay wiyn owdaw wiy? owhow /ez owhiy yad owsa yuw. FIRST G R A D E 542 7 7 6 6 6 6 6 6 6 5 5 5 (conL) (coni.) (coni.) (con t.) (con t.) (con t.) (cont.) (coni) (conL) (cont.) (cont.) (cont.) igw il. inf ing inv iQf iQl IS£ itb ith iva i?. Jowk k.w k.& khow klaw ksp ksae l.ay Ibty Ifa Ikl Itay ItV liyh liyw liyz m.J m./ mda m£l m£m mna mp. mpt mpa mya mal mba ma. mawt n.p niuw ndh nds nlE nna npa ns. nta ntf ntt nzh nza naw. n£yg n?h n?r ow.k ow./ riy? s.m sak sba sdaw sfa Siq sk£y smc ss£y sa. saf saft set siy. S?9 t.h thiy tawt tayg tiys tuwf tuwr t?8 ud. uka um. vmay vmiy vri vse vte vwa wak w£m aam a?h e?J at£a aedd «fa aega aekh aeml aems aevE «?. ae?h x?a awtò ay.g ay.h ayba ayda ayhaw ayh£y aylu aymd aynl aynw ays. ayva ay?t £y.w cyiG £ykae £ynj £yr. £ys. Eyt. £yve £yya £yza ly.d ly.t lybi lyC. iyg£y iyk£ lyli lylay iym£ tyma lyniy lypu tywa tyzi iyzm lyaw tyab tyaen uw.b uw.a uw.ay uwm. uwm. uwzd uw&ae ?.f ?-g ?fi ?gr ?miy ?own ?riy ?/iy ?ah ?ar ?ays c J .a& ..e -iy apt ar? at6 a?m bar bla brow bawd bawn bayt bay. e.? d.n d-y dar dba dowv driy dz. d&£ dta daa dayj daym diyow diya duwy duw& duwe £a. £ly £nj hayd haya hiyb hiyj idz ifa igs ika ilk ilm ils lit ila i may imiy inr inae IQ& isg isr «g izk izp I8l Ian k.? kal kat kba kda kow. kra ksl ksw kar kftae k«e kaes k£y/ l.h Ibi Id. l£d lhae lir, Imow Imiy Inay ite lya Izaw las lak laef lawn layd liya l?a m.£ m.l m.t man mb£y mhiy mil mliy mmiy mowr mpl msh mw£ m/iy maf mayae miyh miyz n.a nbEy ndw nfiy nhow nif rue n}a nma nowE noway npl ns« n8a nayf niyi niym niyEy n?b n?l n?s n?6 ow.t ow.y ow.ae owl. owmc ownow yuww aymft ..aw ays£ adiy z g ayv. ag. z-I ayz. agz Z.BY zbi arb £V-6 zfa £ygr ari Zll EykEy az. zza £ym. a?6 zaw? Cyst a?a aim cywiy bad alz Eyan bi? amiy iy-/ bra an. ly-ay bad ba-e ans lygi •.m tyka baya B-t bayz lyla abay lyn d j tyzn d£r adt aga dij lyal dim aka lyar aie lyas dri elk uwnz dst alow uwz. daen amd uwOaw dEyv •m6 uwer diys ans ?.* elay arj ?iz cl? arr cm. ?i? ery ?now £mb avm ?6E £pt ?6i £rs a/iy azl ?»b £S. azow ?ayk £tl a?k ?aym £ Z . a?iy ?ayw £&a £?h *k. ?iyt aki £?S 6 aka f.a «nz -bay fai aBiy .dey fit aw.. -h£y fia awmc .lu fuwd awns .m£y g.ae awnò .naw gna awts -OW. gat .owv hai ay.s has ayga aykm -pa hwa ayte .sac h£yt hiym aymi .wu aymm hiy? aymw • 0 ib. OWlt owk. owzk owò£ owfci owòey paz p£p pmay pad paz piys Qta Otay Otuw rjan r.d r.f r.n rh£ rhiy rid ril rip ri? rja rkr rlu rliy rmiy rna rpa ryuw rzb ras rat r6i r&ae rab rak rat raef r£yk zh£ zmaw zown zpl zpa zjiy zya zzi zzay zaf z6£y zah za& zaet zayd zayl akt an. and anm aniy arjt ar£ arm arw e.ae òaz &£yd &iy£ a.g a.l a.n ahm ahay aks Wll akiy w£yd alf wfyz alg wiya ana anuw /at aps JiQ apa y£apiy yt 9Qk y£t yaw aruw z.£ asay as£y z.l z.a ati zar atk at? zdi aziy zda zgf az? -bae -dr -dy .de .fa .fiy .ha -li .ki .la .ma .m£ .n6 -pr .r£y .sa -sp .s£y -ti .ts -tw .tay «y -Ji .ar .8a -sp .as £S. £td £th f.ae fiQ fown fowr fut fyuw fes g.a gbr gfn gruw gel hat ha? 543 TABLES OF T R I P H O N E S 5 5 5 5 4 4 4 4 4 4 (conL) (cont.) (cont) (COOL) 5 (conL) (cont.) (conL) (conL) (cont) (conL) (conL) (COOL) ownw S.t v6ow 6tyg aydô UW-? ag. £nb Itt liyn nae rak owpa s.ay va. 6£yr ayhow uwdo akt £naw m.ow nas rbay ow/iy sba vah ebow ayin uwms ald £rn nat rhow sda val a£a ayka uwta ait £ray i?g i?k m.r owzi m .8 na? rk. owar sel vap ads ayko ?ar ama £tm Jmay mal naw. rka owayt sha vayd afa aymh ?di an. £t6 Jar mfa nayj rk£y P « shaw wad af£ aymo ?day and £wiy ]an mga nayO rm. Pik shiy wip ak. aynt ?cl an? £?l Juwn mha naya rnt P»t pown si« WIQ ami aynt ?lay arg £?m k.i mkay n£yb rowd ska Wl? amuw aypu ?owl arr £?w k.s mps n£yk rpiy pu/ sncy wayw anaw ayriy ?st arj far kad mp6 ntyf rru pet sowj waya ape aysl ?siy bow6 fba k£i ms£ niyft rruw piyn ssk way? app aytu ?Wl buk fil k£r mam n?k rs. 0-6 ssow wiyb aog aytcy bad fra kl£ mon nayz rsr qmay syuw wiym arv aytuw ?5ty ban fro kmiy mb£y ow.h rtr sa? Jin ara ayvi ?ayg bay. f£ys kow. .maw ow.n r/m scym /an asd aywi ?ayn baym fiyd kowm m a d ow.s rzt Qap suwn /er asp aywu oy.. bayft mayO owba ra. t-i as« ayz. bays ksf m£yb owbay raeé r-8 rda tak y» yal gi» gowb kra Qar atw ayar C.a gowl ksfi miyw owiz r»g tbe yam avd ayaz .ah iin gat kti n.l owl. rayz r£k tbay yuwh aw£ ty.b .am Ct9 gas kta nad owla ray? rfay tdi z.k azp .b£ itiy h.a ku? nan ownC rg£ tdaw z.n •&t ty-? £ydaw .baw Cak hi? kwiy nbay owny rim tfr a6i cygow haq kad nCiy tfa a?d £yiz .£m £am ris *-V z.e OWll r£yg r£yz Can hawd kacf nd6 owts nyz rk. tha zbr aTf tyla .hay d.k hawt k£yv nd? oww£ ruwft rka ri. tid zdey a?n £ymay d.e hiyt k£yw nfa owyuw s.k tis zka a?s tysa -It -k£ dbiy hiya kiy. nfay owzl s.n rit tiz zma ad. tytb .la d£d iba Iba nga owan s.y rli tkay zmiy aedh £ywf .mow dhow lôa lb£y ngr owep s.O rnz tlay zna aedô ty/a .ni dhiy id. Iga nid oway. sbiy rna towl zwiy af. tyz. .nw dje id£ lu njm owiyw S£S rowk tsf z6a aks cyat .nty dka ida nka ts8 z6£ «nr ly.i .owb dnow id& nka Pil powv sgr rti itg lia rts tsr zav aeno lyday -owy dow. ifw li? nia ptuw sku rw£ ts? za? ara lydey .oway dra Iki nna pwa sowi rya tye za? any tymay -pty druw il® iki lia nowz P«i sow? rzd t6i zayk as. tynw dal npuw p6£ spl t6iy 0 - atm lypow da? ikl il. lowi rzf -piy .ta lowp nn p&a sruw stow QZ. QZ. 5 A .C£y riy? ska rzg tay af. avs typiy .t£ dawd ilh lue ns£ Q.t ran taa afy av6 lyra .w£y day. ima lw£ nsk Q.? sye rag teyb aan lyra d£yi inb Iwiy nsm qda sfli ra? tcya 39 ok. awdi lys. .ad diyt ink l/iy nt£y rjk. saw rad tuwp ol. awnn lytc .a. diyk inm lof nvay Okiy saefn raya uks Dll awza lyyuw .awd duwn inow 16a nwa Olay sayg rcyl ual ome awfl. lyzh .ayr £dr iqa lad nwt ijw£y siyd rtys v.a ont ay.d lyzt .ayv £dw iqw lat nwa qza siys riyf vdi an£y ay.k lyzw .ayo £l. iijy lat ny£ oal siyb nyp vid aar ay.a iy6aw ai. £lm la? nzi qan tan s.d vtuw uw.d ad. £low iQay l£yb nzt r-y tba vza »•I ôaed aybc s.f aybi uw.y adow £may itf l£yh naw rag tg£ .&0W iq8 FIRST G R A D E 544 4 4 4 (cont) (cotlL) (cont) ztfy azj azk aza aan oiyt a?i a.a afii adm adw adz agn ariiy anp ana aqk ash asr atb astk atl atay az. a?k awnh awni awnz awsa aw8. aw?w aw?a aybay aydaw ayff ayfi aygi ayhc ayha aykE aykl aykiy aymb aymfy aynb aym ayncy ayss aytow aytr ayts aytw aytiy tgr tm£y tsl tu ttuw tjiy tal ter taj taiy tas ttyi ttyl ttyy tuww udb u?n V.? vda vi m vòa vòty wiy. viy. wa? w£t wcay W£? wik wis wiyf wiyy /iyb /iya /iy? yah yas yuwï z.r zba zdaw zen zfr zfa zha *U zkr zka zlE zma znow ZSk ZWl ZW3 zyuw zzi Zòl zat zaw zan zaym ziy. afb afa 3b 'anh 9QW org an arj azw afta e.a Gruw Oam Oawz Oiy. bet bcyt 5iy. a.r a.e 90S add ade adr ®Q£V ajow akow «lu ancy apa apow apr arow asb asow asr asa atm avk avw a/a 4 4 3 3 3 3 3 3 (COOL) (cont) (cont) (cont.) (coni.) (cont.) (cont.) (coni.) far fayr fl-b isl isp i se fl-£ IS? Ila IlEy InEy Ipi Isk Isn Isa lt£y Itiy lyuw Izi Izz Iza Iza l&E l6Ey l&iy laf lag lap lad la/ lawd lay 8 lay h layi layv liyf liyi liyl liyt lu ws m.a m.6 ma. mag mdl mdaw md£y mg£ mid mik mit mm. mmi mna mown mta mtuw mzi mzm mzw mzz mzaw ma/ maws mayr mayw may/ mayy miys miya miy? n.r 3 .an ayvb tywow .aa ayza lyzb .ba lyzf -bl ayal -Ci ayOa lyzg .da ayOa lyzl ayam lyzp .£l ayav lyzs .f£ ayad iyz6 -81 ty.k tyOr -ga .h£ Ey.p tya. Ey-8 tyad .how cyd. iy?a .kow Eydow iy?iy -kay Eyhaw uw.w .liy Cylz uwdi .ma Eymow uwdow -niy £yro uwty .oww Eysw uwga .ri uwgr .ra eyti £yvm uwiz .ruw Eywu uwmc - S S Eyap uwmt .sa cyar uwma .tu cyayw uwmiy .wa uwn. .waw ly.e lyba uwna .am uwr. .af lyfa lyfc uwsc .ad UWSl .ay? lyfa lyhiy uwtay .iyv lyk. uwvd .?aw uwyuw ..Ò lykl cyka uwz. a.a uwak a.? lylf lylk ?.i abiy ?.k aòi lyll lynn ?.r ada adaw iyn8 ?da iyn& ?da ak. lynay ?d£y akd lyow. ?£v akh lyown ?fa alh ?ki amm lyp. lysa ?kay amay ?n£ anv lysd tysl ?ow. aps tysow ?s. aqk lysuw ?af ar. arf 7as iytlyta ?8W ary lytiy 7af ar6 lywi ?awt asb dayh dayw d£ym d£ya diyh diyn diyt diya duww £. s £ah £¿8 £da £dj £dn £dy £da £gz £ja £kf £ld Eli £lv £1/ £lz tob £na £iys £n£ (now d.d £na d.i dad £pa d£m Ere dgow Erh dhi Eri Erow dha Era dig div trh Esh dij dlay ESl Etn dna dow. Ett EW. dr£ dra Eza dray Eal dsw f.w fda dsa dw£ fis dwi fia djiy fra ft. daa dOr ftò d6i fwa da/ f&a asp atb ath at? azt aa. aan a?s bat b£l b£t bowt br£ ba. baq bawb£ys biym biyn biyt biyw bayn Cnay Ct£ Cav g£6 itk gowg itò gowp itaw gowaw itiy gz6 IVI izb ga? gan i8. l6£ h.w h.ò lòi hab iaz hway i?h hah i?i ham i?n haq Ihar lao Jaek has haw. k.f hawk k.m hawz k-P h£yd k.t hiyp kan huww k£v. i.h kik kim l-W kja i.a ikss k&Ey idy iday ka. kah if. ifa ka/ iga ka? ign k£yt ijuw kiy. ikb I.b ika laq ili Iba ilow Ida ilz Idb imw IdEy in£ l£? Ifi in/ ipm Ifa Igr ipa IQ£ lhaw iqr lip iqa IH irl Ik. ish Ika n.e nbi nba nbiy nbay nò. ndy nda n£l n£m nge nha nhaw nji nki nkr nkay nkiy nma nmfy nown nows nowy now? npa npu nny nsa nsl ntg nth nt/ nta nve n/£ nyiy nzb nzf nzr nar TABLES OF TRIPHONES 545 3 3 3 3 3 3 3 3 (com.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) st? swEy SOI som son s9r s5£y sad saf sag sawn say. sayw sayz sEyi siyi siyz siyay suwz t.d t-g t.k t.n t.y tdr t£S tfo tfiy tgow tig tim tkl tkr tli tky tnow tnaw towk towr tr£ tra tsE tsj tsow tss tse tyuw tof ton tei tôEy tea taè tar) taya t£yh tiy. tiy. tuwk tuwl tuwj udf udk udn uk. ulula upa ut. Utl utä V.W v.ae v.ay var vrae vr£y vyiy VZl v6a vas vael v£yk waj Wl. wiè wit wiw wowk wown wo6 wor wot way. wayh wEyf w£yh J.ae Jap Si P Jmay Jur Jtyp Jiyf Jiyn Jiyp Ayr Jiye yuw£ yuwt zan zbl zbiy z£r zfa zfi zfow zfay zib zja zkl zm£ zmow zna zta ztr zway zw£y zzae zzEy zor z9i zayh zayp ofô og. oga olb Olk olae omow omay onk onl orf ory ore oray oriy ost Otl owr oz. ozh DZÖ 061 oak o?t ïal e.m eiz emiy 8 ra eta eoi ean eaen 6ie òac ôaEy ôaes ÔEyl ôEyn öiyay öiy? a.E a.y aar aò. gen acEy adg adh ady adz adae afae afEy agu ah£ ahiy ai? aja ali alh ali aim alp air amn aph apw apae 3Q. ana as? atd atf atg atn att atj avh avs avt avz avae awu ajuw azj azy 989 aöiy aEyg a?ow a?ae a?£y aedk aedr aedo aedae aefs aeg. aeli aem. aeng aeoa aesw aett aevd aevl aevm aevr ae6r ae?f ae?l ae?ò aw.ay awka awso ay.f ayj ayb£y ayfae ayhiy ayk. aykw aymf aymt aymj aynz aysa aysk ayta ayth ayvr ayvs ayvy ayya ayow ayas ayaef ay?ö ay?ay £y.m Ey.ay £ybae Eyduw Eyfr Eyhow Eyhiy EyiO Eyja Eykl Eykt Eyku Eyl£ Eymt Eymaw £yni typt Eypu Eys£ £ysi Eyso Eytf Eytiy Eyvd Eyz. £yzt Eyöi £y&a Eyaen £y?. £y?b ly.n ly.p ly.y tybaw lyda lydr lyEj lyfl lyfr lyfaw lygo lyga lyha lyif lykr lykiy lyln lylae lymuw lynz lyp. lyrf lyrt lysiy lyti lytow lytu iytô lytuw lywiy lyziy lyon iye. iy6o lyak lyat ne. na. naé nawt naw? nayEy ntyt niy? nuws n?. n?f n?m n?ay n?Ey ow.d owbi owEn owEr owha OWl? owka owlb owlf owlm owlz owlay owmi own. own. owny owpi owpl owps owr. ows. owsd owyE owz6 0W9? owaen owawt owayh owayk ow?a p.w P-? P£l pid pij pia plae pity powl pra prae priy ps. psa ptl ptaw pu? pol pam paec pEy. 13.1 0-m Q.W Q.ay t]ba rjbo QEI QfO Qgow ogr QU] Qk. Qkl QQa ijyuw r)äae r.l r.m r.ow r.p r.J rab ras rbE rbiy rdae r£? rfu rgi rha rhay rif ria rkE rko rmae rn. rny rnay rnuw rowl rowz rowô rsb rsow rt. rtw rtEy rwu rwEy rzi rzs rzw rzo rog rôEy rôiy raz r«Q ray. rayk rayv nyg riyk riye ruwa r?ae s.a s.f sar sboy sda sEk SE? sfr sfo sfay sgu sig Sil sir skow six sma smow sow. sowd spa spi spr ssiy (cont.) uwwiy uwjuw uwyiy UWZl uwzo uwia uw6. uwe. uwam uwap uwat ?.t ?£m ?fr ?ka ?kl ?k£y ?ma ?n. ?ow. ?ra ?tô ?w£y ?or ?ag ?aet ?aye ?ay? ?£yg lytyg ?£y? ?iyd iy?Ey ?iy? uw.t uw.ö oy.ö uwbi oyn£y uwd. oyz. uwduw oyz. uwfr 2. uwha uwhiy .al uwin .bu uwit .boy uwki .ca uwkae .èae .du uwn. uwnò .£r uwp. uwsEy .fi uwsiy _faw uwtiy .fuw uwtuw .1. uwv. .id uww£ .iw (cont.) .ks .ku Ja -ley .mh .mm .maw .nd -ny .nae .owk .pi -PS .pae .paw .ru .si .sn .say -tr .tiy .uu .v£ -VI .va -Ja -se y .Juw .yn .yu .ov .ow .00 .aj .an .ay .aea ..u ..uw a.w a.a ab. abl aba aö? adh aday aft agd agn ag£y ak. FIRST GRADE 546 2 2 2 2 2 2 (con t.) (con t.) (cont.) (cont.) (cont.) aka akb alb alz alft aliy an» ama ame an. anf anh ani ann anft anay ap. api apiy an ars arw ara aray asft atd atf atg ati atl atr att atuw ava az. aag aak aay aaz aawt aW a?g a?h a?t a?k a?l a?r a?y b.a bba bea bif biz bluw bra brae briy bat baa be. beb ba. bawò bayd bayw baya bay? btyb biyd biyh biyi biyl biyr biyy biy? buwt bayfl e.t i.w S.e iak Car £cn tir ClQ Cit £eb 6ag ¿an òayn C£ys Cuw. Cuw. iuwg Î?8 d.b d.c d.l d.p dae dbay ddi ddey des dfa dfi dfr dfa dfiy die di£y dk£ dlc dliy dmi dma dmiy dn. dnn dna dn? dowz dro draw dsa ds£y dta dwiy dzi dzl dzw dzb dam dae dae daw? day. dayg dayi dayk dayn dayv dEyk d£yn deyr deyt diyb diyj diyft duwb d?iy £-8 E.h E-W £. 6 ca. et. £db Eds £dz £dò Ed? £J£lb £11 tip £lr £lw £m_ £mi Enk En* £pi £pw £rd Erk £rp Era £sk £sm £t£ £tj Etay EtUW £v. £WS £Z. £zl hawy haway haw? hay. hay. hayn h£ya hiyi hiyl huwh huwk uf us i.a uay 11. iCuw ifd ifi tfl ifô igd fl£gim ig£ flt? iflf igh gla gn£y igi gowr igp goway igO gow? igiy gr£ ili ik. gsw ikE gzm gaw ikiy tlb ga? gOi ile gag ila gam il? gav imb gaz imd imE h.m imv h-J inC h.ay h£b in] h£l me hiC may his iphowb tps iqh hta hwiy irg irk hev hab irs haa iny £&£ £ad £89 Eayw t?fl £?P £?r £?t f.h f.6 f-ay f£n f£r f£S fik fin flow fme fray fsa ft. ftl fud fwi fwty fan f6£y fad fas fat fayf faya fiy? fl-d fl-k 0-n 0-6 gaaw gba gdr gduw (cont.) 2 2 2 2 2 2 (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) isv Iti itow ita ita itEy ituw it? ivd ivk ivw iva iw£ i/f i/P i/w ijuw IZJ izl IZOW IZW ize izaw izay iziy iz? i9b i9h lOr lOs iOt iBa tee i0& l&E tab lan i£yg i?b i?d i?m i?& jar J£r Its J« M Jin le. Jfyn Jiy Juw£ Juwg k.b k.l k.n k-J kaC kak kaa ka? kba kbiy kda kfi kfe khfy ki. kiC kiz kliy km£ kows kowe kr£y ks£ ksg ksk ksow ksy ktl ktuw kul kun k/iy kya kyuw kza kas ka? k&£ kag kav kay kab kap kar kaa kawt kayz k£y. k£yd k£yj k£yk kiyb kiym kiyz kuw. k?s l.d l-£ l.f l.r lb£ Ibi Idf Idm Idow Idr l£. l£k l£r If. If£ Iga igty km lis Ikr IkEy Ile III Hay lm. low. low. lowt lowO lowò Ipe Ire Iru Iray Is. Is& Isiy Isuw Iti Ita Ituw Ivi lw£y iy£ Izd Izh Izk Izm laz law left lam lawt layz laye lEyl l£yz l£y6 liyk liyv liyft 1?. mar) mb£ mbi md. mds mday mfay mgow mha mhi mhm mha mke mkx mis mmow mma mpr mpaw mriy mtr mué mvE mwa mzg mzl mza mz£y mai maw m8r mfti m&a meb mao mag mak maw? maya mayiy m£yô miyd miyg miyow miyy miya muwn m?s n.a n.g n.ow na. nah nak nb£ nbl nba nfi. net nex nCay nda ndt n£t nfa nfa ngi ng£y nh£y nhuw niw nja njuw nk. nia nlu nia nna nnb nnaw nnuw now/ nowa nowa nowiy npi npr npiy nra nra nruw nsd nsa nsô ntd ntk ntw nty ntaw nvi nway nyu na] nay nak nar nav nawa nawiy nayt nayow nayy nay a n£y. n£yh n£ys niyC niyl niyn niyr niya niyay nuw. nuwn nuww nuw/ n?ow n?e owba owbay owd. owdx owgi OWlf owkm owkr owks owkiy owla owlg owl] TABLES OF TRIPHONES 547 2 2 2 2 2 2 2 2 2 2 2 2 (conL) (conL) (corn.) (cont) (cont) (conL) (conL) (conL) (cont) (conL) (conL) (conL) qat oayl r.E r.r r.a ra. ral ran rap raq rbow rb£y ri£y rdw rdb rday r£fl r£v rfi rfow rfa rfl rha rhi riC nv riw rjuw rkow rlk rlay rmaw rmcy rn. rn& rniy row. rowt rowh rowp rows rowt rpl rpa rsd rsl rt. rtm ruf rva rv£y rwi rwo rway r/e rfuw rye rz£ rzh rzl rzft rz* r8i rftow raf rah rap raj ray raw? ray. rayh rayi rayn rayy r£yi r£y/ riyr riyft ruw. ruwd ruwp r?d r?k r?m r?6 sa S.I s.r S-D saf sa& saa sba sb£ sba set Sf£ Sfl sga sgow sga sga sim Si? sk£ ski sks ska sl£ slow smi snx snay sniy sowb sowa sp£y spiy spuw sru sra SSI ssay stf sty svs swa sjiy sah sar S&£ sat sav sad sawd says saya say? s£ya s£yd s£yv s£ya siyb siyf siyh siyk siym siyn siyw siy? suwp t.£ t.l t./ tal tam tb£y t£p th tt& ti? t]« tka tka tla tie tlu tla tm£ tnay tn£y tnuw towm towz truw tsp tsy ts& tsc tsaw tscy twi two t/a t/a t&ow ta. taz ta6 tact taw? tayw t£yd t£yr t£yz tiya tuwa tuwi tuwy tuw? t?i t?w t?a t?ay u.. ud£ udl udr udt udz uja ukm uld umz uns un ust ut. utd uuuw uja u?a v.d v.h v.p v.t vba vda vfi vfr vfa vh£ waw. wayf wayi wayn wayay wcyb wcyl w£yt wtyy w£yae w£yaw wiyj wiya /-• Jar /fa Jt? Jm£ Jow. /owe /pa Jud Jed /ep JiVl V£l y£? yie ynow yus yej yeq yet yeb ye« yen yce yuwi yuwl yuwp yuwe yuw c *-J z.p zbc zfie zd. zlu zla zlEy zliy zm£y znw znay znty zray zr£y asa atm atuw edk edw ecn ef. efm efow efy efay efuw eg. egl egz •I* ejuw eke eku eld ell eln el& el? em£ emg amr emj amy epb epf •pay ep? er£ eru esf esg esh esm es& etb ath etp ete eta eva evf evp evfy ews ejow ean e6m e8r eOaw eAa eap eaa eet eiys e?a e?c a?l a?p a?r e?t e?y abl abe adb adn ads aday af. ag. agz aiz akb akf akm akr akw am. amb ana anC anf anaw aps *piy aqb aruw as. ata atf atn at? av. avf avn azh aet ae. aet ae? »?fl a?i owlk pfe owlr phiy owlt pii owliy piz owmn pic owmo^owk owmr pows owmu ppe owmo ppiy owmiy prow ownd ps. owng PS£ ownz psi own» psow pst owp. owpiy pt. ows. ptl pwi owsi owsk paf owt. pef pes OWtl owtu pav owwCy pe? ow/i pae owzd paw. owzf pawt owzw p£yn owOe piy. owftiy piyb oweb piyow oweh piyt owek puwn owayd Q-b owayn 0-s owayw q.9 owiyp Qdt 0W?1 qdaw ow?w ijfe Qlt P-b p.d Qki p.h Qlt qmiy pa qpow P-J p.n OQi qsow P-P ijst P-6 pan ijwi pat qza pbay ODl pdaw q6i p£d qBa (jam pfa VI. vis vkl vka vkae via vnay vr£ vs£ vst VW1 vz. vet vaw veft w.. war w£. wig wray ws. wul wun wwe weh wow weft Z£V zgi zgr zka zk£y ZS£ zsk zsl zsw zwa zwE zom zef zayn ztyg ziy. ziyg ziyk z?a z?aw a.w a.& a.ay adi afi ags ait akn ak& Din alt aly alay am. anp any an? apt ao009 ark arow arz asm ass as& ase 3W& azi 32« aziy a6a aal a?k a?a e.a e.d e.? OlS On esa etuw Sad Oat 6a? eea Oeb e*v Saw? 6iy. 6£. &£? &IZ ftny 6a. »8/ 6ey bob &ee 6«y&£ya &£yb 6£yj &Eyp 6£ya &£ye &£y? ftiyw a.t •-I eb. ebs ebu eba e££ eCi FIRST G R A D E 548 2 2 2 2 2 2 l 1 1 1 1 (coot.) (COOL) (cont) (cont) (cont) (COOL) (conL) (conL) (cont) (cont.) (cont) (cont) a?a m? ay aw.? awtn awit awme awnw awss awst awsw awta awtm awta awtuw awwa awwiy awye aw6e awer aw?k aya ay.t ay.y ayba aybuw aydb aydt aydiy ayf. ayfo ayfiy avflo ayu ayiz «Vii aykd aykh aykow aykj ayky ayk? aylE aylt ayla aymuw ayno aynO aynô ayowp ayr. ayre ayr» aya. aysEy aysiy aysoy aytj ayt& aytay ayvt ayvO aywiy ayjuw ayyu ayya ayòi ayfte iyk. lykow lykEy lyld lylu lylo lymi lymow lyma lynow lynEy lyowp lyowv iypf lypr iyps iyrd lyrg lyrow lyny lysm lyss lysw tysaw lysay lytl lytr lyv. lyvi iyy£ lyya lyya lyzk lyzow lyza iyz6 tyzaw iye. iy&£ iy6a lye. iyed lyaz lye? lyat lyaftv »yaya lyayz iyEyt iy?t uw.f uw.l uw.p uw.s uwar uwba uwbsy uwdaw uwfiy uwga uwiq uwkl uwkow uwlb uwld uwtl uwl& uwmt uwmO uwna uwno uwpl uwpu uwpe uwn uwru uwrae uwrty uws. uwsw uwsy UWtE uwts UWVB uwziy uwft£ uwftiy uws. uweb uwes uwe6 uwa? ?.d ?.n ?.e ?ah ?ap ?b£ ?bl ?br ?biy ?diy Tfay ?h» 7ha ?hay ?hiy 7ik ?im ?ko ?la ?lo ?la ?ma ?ns ?na ?nay ?owp ?pe ?ruw ?Sl ?sk ?sr ?S3 ?t£ ?tm ?tn ?tw ?tsy ?wu ?W3 ?way ?ze -a? .bow -b/ .Ô£ .iay .ÒUW .daw .diy -Ef .£k .£w .£a .fow -fu -fy .fa -si -flu .go .ga .gaw -gay -g£y .hu am as aa -Ja -J® .Jaw -lay -UV .Juw .kw .le »9 .saw .suw -t. .th .tow .tt .to .uh .vow .vr -wg .wow .wuw -JE .Jow -JS -Ju -ya -yi -V« -y£y .za .zaw .ziy -of .ok .OS .2a .8w .Oaw .Ouw .6r .&e .a£ .m. .muw .n. .nn .np .ns .owd -owi .owm .owp .OW& .pow -pay .puw .ra .r£ .3. .eay .a? -ag .ah .at .ak .aq .aw .aò .aa .aw. -awa .aw £ .awi .awt .awu .away -ay£ -ayay -Eyh .£yi .£yow -£ya .£y? ayb .iy6 -iyd ayh ayl ayz .iyuw .uw. .uwb .?h .?l .?m .?n -?W -?UW ..V ..z ..£y a.f a.g aa a.k a.m a-/ a-y a.aw a.ay aah aam ab£ abo abaw ai. a£f atb aCa aiay ad. adi afa afb afu af6 afty aga ag£ agj agk agr agu agw age aga ah. ahi ahm aht ahw aha ah£y aj. ajuw akk akw akz akò akaw akay at. al£ all air alt alw aly ale alaw am. amd amg amh amp amw amz ama ank anm ant anO anuw aph api apm ap£y aqi arjt are ar£ arn arow arp aru arv aro arEy any ask ast at£ at] atk atm atow atp a tv atw ate ata ataw atay avh aj. a/a ajm a/u a/e aza azb azl aze az? ait afti aóiy aa. aeb aal aap aar aav aaw aa? aawe auw. a?a a?b a?p a?o a?e a?a a?iy a?? b.E bab bal bam baa baaw b£i b£S b£6 bf£ bi. bid bis bka blow blay bown bows bow? bsk bsa bui buj bue bwa b/iy bz. bze bo. bo? beg beh bej bes be; be& beay baiy bat bar bae bayj bays bayz bayiy b£y. b£yk bEyr £ynt £ynz £yna £yowl £yr. £yrb Eyrm £yray £ysk £y>l £ysm £ytn Eytr Eytw Eyto Eytuw ayek £yji ayel Eyzd ayep Eyol ayav £y6m ayawt EyOr ayeyd £yak ayey? £yal ayiy. tyaij ay?. Eyad ay?k fyaw? a y ? a Eyiys £y?a Ey» Ey.t ly.g Eyar iy.1 Eybr lybay Eyda iyb£y Eydh tybiy Eyda lyCi eycn lyd. lydn Eyfe Eyga lydaw EygEy lyduw iy£n cyit Eyk. iy£r £yka lyfi £yk£ lyfow £ykm lyfiy Eyko lygr £yk6 tygu tykiy tygz Eymk iyhE £yn. lyhow lyhaw eyn. £ynd lyhay £ynow tyit Eyna lyji ?of ?DW ?8l ?ad ?at ?av ?ey ?ani ?aw? ?ayl ?ayow ?ayp ??a Dyzi oyflr 1 .a. .aa .ab .ad .ag -aj 1 TABLES OF T R I P H O N E S 1 1 1 (cont.) (com.) (cont) b£y& biyj biy6 boyi baya C.b C.h C.k C.n C.y C.ay Caa Ca? Cuwa doww C?uw dowa d.f dowiy dow? d-| d.ow dpa d.aw dpay drr d.ty day dru dr£y da. dam ds. dan dsa da2 dsc dba dsiy dbr dti dba dtow dba dtu db£y dtw dda dta dda dtcy dday dur d£. duy del duay d£v dwa dwow dca dyu dg£ dgcy dya dha dya dh£ dza dha dzd dhcy dzf du dzh dir dzk dzm di6 dja dzn dki dzp dkr dza dko dza dka dzay dk£y dz7 dlo dap dme dat dmfy da? dna dOi dng d6cy dftiy dnh dnay da. dniy ds£y dnay daf dowl day dowow dawk dowQ dayf dows dayl tiz Cfa Chi did Cil Ci? Cki Ckr Cka Cma ipt Cray esc Csow Csp Csa Csa eu Stay Cup CW3 Cwa Cya Col Cop COi C6l C6a Ca. Caf Caym Cayt Caye Ccya CiyJ Cuwd Cuwn Cuwt Cuw6 1 1 (conL) (coot) dayp daycy day? d£yd dtyg d£yh dcyy dcya dcyft dcya dcyiy d£y? diyC diym diyv diyy diya diyay diycy diyuw diy? duws duwa duway d?v d?a £.b £.1 £.8 £kv £ka £la £.ay cab £bb £ba cbaw £biy £Cy edd edc cdt cdaw cday cc. cfm cfw tote" coy ck. ck. Cki Ckt 1 1 1 549 1 1 1 1 (cont) (cont) (conL) (cont) (conL) (cont) (cont) Can caz can £l£ cay. £lh cayg £lt cays £la c?. flaw c?d (mow c?f Emp £?k £?l cma cma £?a (maw C?6 £nC c?ay £nf c?iy cpm f.i cps f.k cqw faf £rf fan Crg fae fba £rj Crr fba Crt fdc cr? ft. Csb fck Csi fC6 cs/ ffa fhiy £»y £80 fiz Esay fia csiy fjuw cs? fks eta fka ctb flc ctl fla ctr fmay fow. cty ctaw fowa fpaw ct? Cviy fri Ewb frow Cwm frcy twow fruw (WW fs. fs. CJ1 tzg fsa czz ftg ftm cza Czay ftow ftu £Z? C&ty ftw cab fta ftuw ft? ful fun fway f/iy fOa f&c fab fag fah fam fap fav faw faz faft fa? faa fay. fayd fayk fayt fcyn fcyr fiyh fiy; fiya aid eif gig a» gia gka eaww eay. eayz gcyd giyb giyr Oiys 0?- 11. U. l]W Ha ikC ikr iku ikj ikft ikey ik? ilf ill tin ilr ilu ilv ilw iiy ue ilcy imh imp imt 1 my 1 maw inuw lown ipipd ipt ipv ipz iQl iQn iqow iQaw iQiy iQ? ir. 1 row irz ir? is] is/ isy is6 isay is£y isiy isuw ita Itfl ItP itr it/ ity ite 9k« hayp hays hayt hey. hcyw hiy£ hiyow hiyy huw. huw. huwi h?a 91» gkey h.d h.h 8li h.p aiiy gmaw h.t gnaw h.y i-9 gowc h.a 1.1 gowm h.. i.k gown had i.t gowow hew i.a gpc hc6 i.? gpu hi. ibw gpuw hig iC. hir iCa era gray hlay 1C1 hm. iCw as. ask hmay idd hnow idg 9sl gsp howd idh gsiy howp idow hpey ids a/a fUWQ gya hsa idj ide fuwt gye hud gzd hum idaw a-c hwa iduw 8-f e*f gzh hal if. 8-9 gzi he. ifb g-p gzs ha. ifc a-» gzw haf ifh a-t g.w azz hak ifs g.ay gza hat ifu ha. aza ifj a-? ga. azay hah ifay gaa g6a ha6 ifuw ga. haw. 1 9 9 gbc gba gab hawb 19k gcv gad hawn igm g£z hawow igr gaf gap haww iOJ gfi haw6 iey aay Bfr ggr gaa hawa 10? hawiy ih. ghow gaa hayj iha gha aa. ahey earn hayk ihow gib ear hayl iha IV. IV. ivf ivg ivh ivy ivay iwn i/b i/t 1/3 i/a ijay ijiy iza izC izr IZV izy iza law i6a lOk iep i8y tea tOaw i6ow l&W iM i&cy tad laa tan i?C i?P i?r i?y i?a i?iy J.h I-i J.k 1-3 1-6 550 1 FIRST 1 1 i 1 1 GRADE 1 1 1 1 1 (cont) (cont.) (coni.) (cont.) (conL) (conL) (cont.) (cont.) (coni.) (cont.) (cont.) I-» kja kk£ kka kma kmc kn. kne knaw kowb kowd kown kowp kowr ksb ksh ksa ksay ksiy kt. ktb kt£ ktm ktr kts ktu ktw ktò kt« kuk kup kuu kua kv£ kvi kw£ kway kw£y kja kja ky£ kz. kzi kad kaf kak kam kan kftiy ka. kat kai kak karj kaw kei keq kawn kaws kawz kay. kayk kaym kayp ktyfl k£yn kcyr keys kiyd kiyi kiys kiyt kiyw kiyò kiy? kuws kuw? k?t kayn l.a i-a l.k I.I l.n l.t 1-y l.z Ifiy Ifuw Igt Ihi Ihow Ihw lha Ihiy Ihuw Ith lii lie Ila lluw Ik. Ikw Ike How llaw Im. Imi Ime lm£y Imuw Ina lowb lowô lowd low£ lowm lown loww Iowa Iowa Ipiy la Ir« Iraw Ircy Isa ls£ 1st Isl Ism 1st Isw luí lun lv. IvO Iva Iway l/uw lyu Iza Izb Izc Izf Izl Izn Izr Izw IzA Izc b. Ion bt ie. leí Mr lea I6i l6ow lal laz leb lap lar lev lea lawz laylay. layf layr lays layt layw laya Iay6 laya layaw l£y£ l£yj Ityp l£ya liym luwi luwk luwz l?n l?3 l?e l?ay l?£y m.v m.aw may mab maf mak mat mba mbu mbiy mia mío mía mda mdb mdf mdj mdk mdm mdr m£r m£s mfv m£? mfl mfow mfo mfaw mfuw mgl mhc mhay mtf mi] mim mi? m}e mka mkr mk£y ml£ mil míe mlay mluw mi? mm. mme mmuw mn£ mnow mnay mniy mnuw mowb mowd mowl mowm mpow mpiy mp? mr£ mra ms. msa mse muy mti mvt mway m/uw mza mzf mzk mzow mzr mzt mzj mzò mziy mav mo6 mee m6C mftiy maf mak mav may me£ mef met main mawd mawh mayl mayow mayp mayv maya mayaw m£y? miyb miyf miyl miye miyò m?. m?i m?m m?n m?s m?ay m?iy n.aw nab nag nal nap nav nauw nba nbaw nói ntp ndb ndf ndk nd/ nde n£g n£i) n£& n£? nf£ nfi nfl nfe ngl nga nge nhw nha nu ni. ntò nig niv ni6 nini. nld nj£ n]& nl£y nliy nk. nk£ nkl nkow nku nk£y nlow nla nl£y nmi nma nn. nowb nowd nowf nowk nowt nowO np£ npe nrk nzn nzp nzs nzw nza nzò nze nzaw nz£y nziy nz? nob na? ne. nOow nOr n8s n6iy nai naow ne/ naz na£y ned neh nep new nez nawa naw£ nawi nawl naww naw& nay. nayb nayr nayj nayi n£yC n£yf n£yw n£ye niy£ niyl niyow niyy niya nuwm nuwt nuwy nuwa nuway nuwiy n?i n?z n?a n?e n?aw n?iy n?? ow.£ ow.g ow.i ow.J ow.l ow.r ow.v ow.iy owb. owba owbiy !•• Ida J£m Itn Jhiy Ik« Jul Iwa Jal loa I&» !•lab J»I I»l lap lav law Jez J«n Jawm lays Jayi Jaya JtyJuw. Juw. Juwb Juwh Juwy k.C k.h k.r k.6 k.ay kaf kam k«a kdaw k£. ktj kc? kft kfty k0r kh£ khi khu kha khiy kifl uy laf lah Ian las laz la? Idh Idz Idty leg l£Z If. Ifk m Ifu tfw ne ISO Isay It. Ita Itr Its nru nr£y nsh ns£y nsuw ntb ntl ntn ntow ntp ntu ntft nv£ nww n/a n/i ny. nyr nza nzd nz£ nzg nzl nzm 1 (cont.) owma owmy owmz owna owni own] ownk owns owowp owowv owpow owpw owpe owog owrd owrf owrm owrn owrt owra OWÍ. owre owti owraw ow£k owray owda owsc owdb ows6 owdd o w s e owdl owsuw owdu owtm owdz owte owday owt£y owdiy owv£ ow£v owwa owfi owwow owfr owwaw owfe owway owg£ ow/a owh£ owya owhw owza owhay owzb owhuw 1 owzg owik owzh owiw owzm owtO owzow owkd owzr owkc owzu owki owzO owkò owze owkEy owz? owlh owol owlw owow owb ow9£ owlft owOow TABLES OF 1 (cont) 1 (conL) owflr prt pre owet o w 6 o f pray ow&ow psd owe. psj o w e d psk o w e d psm owayl psa owaym psò owayowpsa oways ps£y o w a y / pta oways pt£ o w i y . Ptf owiyg pth owiyj ptow o w i y k ptD o w i y m ptò o w i y z pus o w i y a pv£ owuw. pwo ow?h p w i y ow?n PJow?s P JQW?U p y e OW?8W p z i p.f pzo pj pòi pai P-S pek p-t p-y pa. pa. pag pak pam pae pa? pbe pde per pew Pij pfr phe phae pi pi? Pi® powz pow? ppa P«P pea peò pee peiy pael paet pawd pawl pawn pawp payh paym payn payr p£y. ptyk ptyp p£yr p£ys pEyó piy. 1 (cont) piya piyd piyk piyw piyaw puwe P?i P* P?3 o-h 0-1 0-1 o-/ o-y o-e qah qal 08/ oae qbow ijbay qb£y qday qfow qg£ Oflh Ofl> ogz qhow qhe 0« Oi? qJow qkb Okg qkm qkw qka qkó qka Okay qne qowp Qpe Qpiy 00» OOay Qra qr£ On ony qsl 1 1 (conL) (coni.) qse qsuw 0t£ ijti QWE qwe qwiy qye qzh Ozi qzn qzw Oz/ qof qom q6e qò£y Oek oes qet qez qaez qaw? qayd qayk qayw qiys q?e r.a r-I r.jy rad raj ram rar raft rbl rbu rbo rbaw rii rdd rdh rdn rdow rdr rds rdt rdy rdaw rduw at r£l r£r r£t r£w r£z r£e rfa rfl rfy rfiy rfuw rgrgp rgu rg£y rhw rho nk rie rib rl1i rjo rjay rj£y rkw rkz rkay ria rid rln rls rl£y rluw rm. rmt rm/ rmuw rn£ rnk rnl rnn row. rowb roww rpa rp£ rpr rpt rpu rpo 1 (cont.) rr. rr£ rrr rre rrae rriy rsf rsp rss rsO rsiy rs? rtb rt£ rtf rth rtk rtow rtp rtay rvw rvz rvae rjo r/ae r/£y r/iy ryiy rzj rzk rzy rzz rof ram roq roz roe rie rfl£ rOw rej rew ree rae. rae) raep raet raew rae/ raez rae? rayb 551 TRIPHONES 1 1 1 1 1 (conL) (cont) (conL) (cont.) (conL) rayl rayp rayq rays raye r£y. r£yh r£ym r£yr r£yv r£ye r£yiy riyC riy£ riyh riyow riyy riyo riyae riyiy ruwa ruwf ruwh r?. r?i s-g s.ow sie sk. skt sky skaw skay sb sl£y smuw sowf sows sowv spow spa sr£ srow srae sraw ss. ss. ssa SS£ ssw ss» ssuw stb sth stl stn sts stu st& sue saf sack sae? sawt saws sayh sayt sayk sayn sayae s£y. s£y£ sEyf sfyh s£yl s£ys sEyo s£y6 s£y? siya siyE siyr siyt siyy siyo siyae suwk suwm suwt suw? s?. s?. s?d s?i s?n s?6 s?Ey s?uw soye soyuw t.C ta? tbl tbo tea tdae tday tduw t£b t£d t£m tta ttE tti ttay tt£y tu. tu. tun tup tuO tue tVE tway t/ow t/u tab torn tos tee tòr te/ teay te£y tad tae) taez taeo tawd tawn tay. tayd tayf tayh tayi tayk tayl tayp tays tayt tayO t£yn tEyow t£yt t£yu t£ye t£y? tiyh tiyp tiyr tiyt tiyy tiyz S-V sa. sad sal sari sap sa? sbl sbr sbu sbaw sbay sd£ sdì sdow sdr sdae sday sfl sfiy sg£ shi she shae shuw SW3 s/ow syf syiy S3. ssb S3S sot sow soae se. s&ae se. sea seh sei seO se& see t-J t.ow t-p t.r t-V t.3 t.e t-iv tad taf tae t£V t£e tfa tfaw tga tgS tho thaw thay tu tif UP tir tiw tie tka tki tks tk£y tlo tlae tluw tme tmae tmaw tnb tn/ tow. towd town towv toww tpi tpl tpow tpr tpu tpe tpiy tsa tsd tsuw 1 (conL) tiyo tiycy tuwj tuwow tuwz t?t?£ t?p t?ae t?Ey t?uw tsyz u.k U.I u.w uC. ue. udd udg udh udj udow ud/ udy uda udO uda ud? uf. uf. ugf ugow uh. uk. ukd ukE ukr ukz ukiy ulb ulf ulg Ull ull ulm ulaw ulay umf umy uni unk unn F I R S T 552 1 1 1 1 1 1 (COM.) (conL) (conL) (conL) (coot) (corn.) unow vgr v£ys waO It* unt vhi viyb waa Jwa unay vha viyow w a n upupa vha viys waww vih viyt upu wk urd urk G R A D E 1 1 1 1 1 (conL) (conL) (conL) 1 (cont.) (cont.) (conL) yas zng zEyw ani 2er 6-y eòe yav zn? zcya anc íes 6-e eiuw Jwiy yayh zow. ziyb anf e.b &eg adb yiyn zow. ziyd ang e.f 6£w edm waw? JV» /on yiyt zowp ziyf anow e.r &£z adow V?£ way. /or yuwb zowv ziyr anr e.t &£a adp vi6 v?a way£ St yuwf zowa ziyz anw e.w 6i. ed& vkr w.J wayk yuwu zpa ziy6 anz e.y &im ad? ury Vil w-J way) /•I Jam yuwa zpE ziya ana e.ay 6in afl utiy vía w.a waym J»« yuwO zpr ziy? ane Oar &IQ efs uta vmi W_? wayy J»d yuwEy zpty zuw. ao- ebi òir aft ute vmò was wayiy z.a zpiy z?ay ara ebi 6i? eg. utg vma wal weyq J«n /ayk z.d zrt z?cy arb eecy òmay agk utk vnc wal wtyr z.v zra a.a arh Ode tow. ego uts vowz wam weys Jiy» Jiyow Z-Z zra a.y art eel bow. ahi fiyt z.Ey zraw aba arp OEm dowt ahs zba zruw abiy asc 6£n 6r£ ehw zba zsn abay ask ecr ftrow ah£y uty vpc «vap wEyw uul vpow wbay wEyiy ujh vpty w fz iiyj wcyuw Jiya uji vruw w£& wty? Juwd zbaw zsow ai. asy 0f£ 6rv ah? ujt vsi wga wiy. Juws zbay zap aCt at. Oha &we aim ujy vtt wid wtya Juwt zb£y zst ate ata Shay &8i ain uyuw vti Wlf wiy£ Juwb zbay zsaw adE atb 8im &òa ait u8. vtr wih wiyi Y" zda zt- afd atf 8i? 6av ua. w r Wt] wiyow V«- zdc ztC aff ats 6ki 6 « »Jejh uag vwa wiow wiya ztw afk atw Oka 6aJ elk vwa wm. wuw. ya yal zdow uan zdr zta aft ató Orna &aa eia ua? vwiy wmc w u w w yar zday ztiy afw atiy Cowl &£y£ ekw uay. vyi wnd yaa zdiy ztay agb avf Ooway 6£yf ek& uuw. vya wnw J-£ J.ow zduw zup agi avi OpaW &£yi ekaw uuwg vyuw WOW- J-P y " ytg zEm ZVE agi avw Oru 6£ym ekay u?. vz. wowt y£6 zfl zwu ahi av6 Os. ôtyow elv U?l vzf j- s wowuwj.ay ytay zfu zjow aha awE est ò£ya SU uTt vzw wrc ;-? yir zfiy zzn aiq awa Owi ò£ya ely v.a vzy WSl Jba yi» zgey zzy aiw away 8way fttyiy eie v.b vzz wsow J£r zaw aiz aja Oyuw òiya elaw vz? wu. J£? yi» yma zgiy v.l zhi ZÒOW ai? azc Oai òiyg emv v.r vol wug Jha yrg zha zat akh azk Son òiys em£y v.s van wu] Ji- yu. zhay zal akm azj 88i &iya env v.e var wup A9 yug zhcy za. akow azz e&E 6iy£y eow. v.6 ver wu? yuk zid zaC aks aa. e&e e.a eown vbi v5i wwiy Jim yun zik zad akv aab Oeg a J epd vbl vaf wal /i» yur ZLL zay. aky aad 8el a.a epm vbr vag waj Ju yu? zim zayb akcy aag eas a.2 epy vbcy vav W3S Jka ywa ziw zayr akiy aal eat aah ap£y vd. vaO wòa JUy ya- zia zayt alg DBS Oaz abk epuw vdc va» w&iy Jma zia zayz alh aaw 6e8 abz eijr vdf va? wa. Jowb y * yab zki zaya air aan eat eia esj vdh van wtC Jowl yai zka zaya als a?. Saw. 96k asy vdw vap wai /owz yaow zkay zay? ale a?m Bawd eCm esuw vdcy vaa wap JsE yaa zmi zEyh AL? 2aa Biya air atl vfa vawt wa/ Jt. yaa zma ziyp ana 2in eiya ait aty vga vtyg way Jtm ya? znc ztyr anb tua euwft eòw evb T A B L E S OF T R I P H O N E S 553 1 1 1 1 1 1 1 1 1 1 1 (com.) (cont.) (cont) (cont.) (cont) (cont) (cont) (cont.) (cont.) (cont) (cont) (cont) av£ e.l aeqi cam awte aydy aysow Ey-E EymC e.n crow een awt? aydz aysp Ey.h Eymh ty« £yea lyEv evi ivpty lyrh evr e.r esd e?a awu. aydEy ayse Ey.r EymJ Eyab iyflyfe evy ae.6 esf awz. ayd? aysaw Ey.y Eyml Eyad lyfEy lyrm avO e.? CSI e?í e?n awzt ayEt aytb Ey.a Eymn Eyam lygay lyrn aviy e.. esn c?r awzz ay£v aytE Ey.e Eymp EysO lyha lyrp av? eb. css e?; a w z a w ayfu aytg Eyab £ymw Eyaé lyhw lyra aw. ebf csy e?z awOw ayfaw ayti £yaa Eymy Eyef lyhfl iyrò aw. aebz CS3 aw.d awfle ayfay ayta Eybi EymEy Eyay. lyim lyray 1 lyrj awm e¿h csay aw.h aw6£ ayfey ayte Eyba EynE Eyayh lyi? lys. awn ats aes? aw.i awòi ayg6 ayv. £yò£ Eyng Eyayk lyja lysf a/i a/m atéb ctg aw.m awòr ayge ayvf £yie Eynk Eyiyr lyJEy lysp Ctl aw.n aw&Ey ayhn ayvg £yd. Eynf Eyiy? iykò lysu a/a aeda ctp aw.p awat ayi. ayvk Eydb Eyown Eyuwn lykaw lysEy aya edf Ctr aw.w awaz ayid ayvm EydE Eyowv Ey?f iyl. lyth aye aedow ctw aw.J awaò ayi? ayvn Eydl Eypow «dp etj aw.y a w a y w ayj£ ayvw Eydw Eypa iyi. lyla lyts ayl £y?g £y?h aym edO ctO 8W.Ò awayy aywow Eydy EyQk Ey?J lytb lyvE ayw aedaw etc aw.a awayty aykr ay/E Eyda Eyrf £y?n lylp iyv6 ayò aed£y aeva awar awty. aykaw ay/u Eydô Eyrh Ey?t lyls lywa aza cd? cvb awaa awiyg aykay ay/a EydEy Eyri £y?a lylt lyway «En cvp awbi awiyz aylf Eyd? Eyrow Ey?6 t yl z lyja azf aefd c w awò? aw?. ayl h ayyiy ayam EyfD Eyrp Ey?c lylEy lyjiy aze efi evw aw?b aylm ayar aevy awTf ayls ayia Eyrt Eyrz ly.a ly.C lyya lymd lyyi aaw «fp efw eygEyg. lymb azcy awd. awdn aevz awdz aw?m ayla ayfl. EygE Eyny lyyay efy evo awduw aw?n aylEy ayOr Eygi Eysb iy-I ly.u lyme aee lymaw lyza a&. aefo ev? awh. ay&e eyga Eysow ly.v lynb lyzr a&r egb cw. awis a w ? o w ayliy aw?y ayluw ayab Eyge Eyss ly.a lynC lyzy e&Ey agi asw£ awkr aw?a a y m o w 1 ayaf £yh£ Eyse ty.O tynd lyzz aa. «h. cww awlu ay.í aymaw ayah eyhp EysEy lyal lynE lyzuw aab cht «/- awliy ay.E aym? ayai £yha Eyth tyan lynf eyam azi e£u aykf lytw aah cha e/k awna ay-I ayna ayat lyar lynh lyOd » t ejt awnf aynf ayaw £yts lyav lyni lyef aa6 aet6 e/a awng ay-l ay.n £yig Eyil Eytl aal aynh aya? Eyi? Eytu lybl lynl lyOa aaa eya awnm ay.ow aynk ayeg eyj- Eyte tybow lynm aef al" ekE ez. a w n o w ay.v aynm ayek Eyte lybe lynr iy&ly&i «cm ckn ezb awnp ayam aynn ayes £VIEykb EytEy lyC. lyns iy6r aen aekft aBzl awne ayar ayna ayawe Eykd iyí£ lynt lyèty aev ekiy ezm awniy aybb ayny ayay. Eykh Eyup Eyv. i'yCk lynj lyaf aayd d . ezp awowl aybo aynuw ayayg Eykk Eyvw lyCt lyny lyah aays el. ezs awpaw aybiy ayowl ayaym Eykr Eyvz lyío lynaw lyaj aayy ezt awsb ayía a y o w w ay£yt EykJ Eywa lyòay lyn? lyap a£yd «ly city CZ3 awsd ayCuw ayowiy ayiya Eyky Eywa lyd. lyowf lyav aEyow aem6 eze awsE ayda ayp£ ayiyt Cykz Eyyuw lydb lyowl lyaw a£yr e m e eat awsh aydE ayps ayiyz Eykay Eyzg lydE lyowj lyef auwb cmiy eOk awsi aydf aypaw ay?b eyl. Eyzi lydh lypd lyem 9?g en] eòm awtd aydh ayg. ay?g Eyl. Eyzy lydm lypE lyes a?a cnEy arto awtf aydl ayrc ay?m Eyla Eyzz tyds lyez a?aw ept cab awth aydm ayraw ay?s Eyli Eyaf lydiy lypl lypt a?uw CIJ- eaf awtl aydn ayr£y ay?w Eylay Eyan lyEd lypw eyaw? e.k «10 cal awtw aydr aysn Ey.d Eyma Eyaw iy£t lypz lyay. iye? FIRST GRADE 554 1 (cont.) 1 (cont) uwlm iyayj lyayw uwls lyayaw uwlt uwlw lyay? 1 1 (cont) (coni.) 1 (cont.) 1 (cont.) UWWUW 7 d a ?ray u w j o w 7dr uw/t 7daw uwjiy 7duw uwyi ?S- ?uwi ?sb ?s£ ?uwm ?uwj ?uw. ?sg ?uw? 7£7 ?sm ??£ uwle uwlc uwye uwzf uwzg 7fl 7f« uwlay uwmf uwzy uwzft 7oy. oy.w oy.e uwmk uwmz UWZ8 7ga 7g£ 7gi 7sn ?sow ?sw uwza uwal 7hw 7haw 7s« ?sty ?tb oy.ae oy.£y oy.7 ?tf ?th ?ti Ttk oyiz oyn» ays. oyst 7tl Ttcy 7t7 ?um oysk ayss ayz£ oyzn uw&£y 7ku uwe. 7 k » uw.m 7L uwef uw-6 uwowl uwev 71e uw.aw u w p w u w a e 7l£y ?m£ uwpiy u w a f uwae uwbe uwqk uwas 7ml uwayh ? m o w u w b a y uwrd uwC. uwrf uwayk ?mo ?vcy ?wa ?Ju ?yuw 7z. oyzw oyem oyer oyuwr uwd. 7euw 7a7ad iy£yr lytyw uwlj uwlz lytye iyiyz lyuwg tyuws iy?d iy?£ iy?f uwma iy?B iy?h uwmò uwor uwmty uwtu ty?i iy?z uwmuwuw6i u w n d uwfls iy?6 uw.g uwn£ uw.h UWU uw.J uwda uwd£ uwdk uwni uwnn uwnt uwny uwniy uwrh uwrk uwrs uwrt uwrt uw8« uwfti uws. uwsa uwfaw uwsk UWfl* uwhi ?.a 7.C ?.£ ?-y uwhuw uwse uwih UWIS uwi6 uwja uwka uwks uwud UWVl uwvt uwvfi ?Jow u w f y d 7mae uwiyC 7 m £ y uw?k 7na uw?ow ?ng UW?8 7nh uwsl u w s o w 7.1 uwhaw uwss 7io ?Jay u w ^ o w 7kr uwda uwd£y uwray uw?ay uw£r uwruw uw?? uwf» uwf« 7i. 7if 7il 7a. 7al 7av ?bo uwvaw 7b» uwviy 7 b « uwkcy uwwa 7bay u w k i y UWWD 7Ce uwkuw uwway ?d. ?ov Ter 76iy ?•/ ?«£ ?aeg 7ni 7nk 7®k ?*v 7nn 7awC 7aw0 ?nt 7nz 7nô 7naw 7niy ?owv 7owy 7oway 7pa 7pb 7pf 7pl 7piy 7rt 7r« ?ayb 7ayJ ?ayt 7ayy 7aye ?ay£y ?£y. ?ty. ?£yd ?£ y e ?iy7iy. ?iyC 7iyz 8.9.2 Third Grade Tables of Triphones Third Grade 477 .m 201 ..a •37 197 •m. .WC 319 196 -?e 297 ?am «V 190 T.. 153 ?an 148 en. 147 ana 145 -y» 294 187 142 wan ».hky layk IV- 253 ..w 243 waz 235 6ar 230 .an 221 .wa 211 ar. 209 wcn 207 e6e 186 ..? 177 n.. 171 .wiy 170 tar 169 -y 6is 165 -?a 163 z.. 162 •ta 202
159 n&e 139 .6a dar 138 an. 136 .am d.. 134 6iq 129 S.. 127 now. 125 m.. 124 ..6 yan 123 ?e. 122 ..h n6c anow 121 99 84 wel -'»y ver 98 83 6tr and hav 97 82 .sow n.? ow.. ..s en6 120 96 81 sem 119 and 117 an6 ers 95 ida 94 did 115 93 .may 6a? 114 92 -6E 111 ard 105 en. 104 ar. 103 kam war 102 ant 100 tfrz tywe 91 bar 90 ..n 89 .yuw ..e in6 88 -yt 85 nde taym den 80 aza 79 72 (com.) 65 (cont.) 56 (conL) 50 (conL) 46 (cont.) 42 (cont) ISt its m.? 6eb era ez. aft uw.. ens ada Cnay 6e. en. nd. pen tcyk ede erw ?an z.a one ebiy eptywe owve stz SIS vriy 71 .now .6iy mayb nyl •gow amy bre fer 78 70 raft 68 k.. 77 fte plEy y»r ?we din zan aywe 67 ern 76 .6a had 75 ada 74 nwty est 72 ..m del 66 Eniy 1.. n.6 wiyw abaw ayke 65 Jiy in. ina tse teg 556 64 for em. enay 63 .be m.w 62 it. itn ••n iys£ 61 an down get bat tyha 60 zin 59 nta al. 58 now. n6£y 57 Ent IQ. kaz 56 55 big 0- a.. ann ty.. 54 dawn n.a 53 is. las kin n.a nar rwe bas ert an? 52 nne ayha 51 -ayw IQ. n?a aybr 50 .ta evr ger 49 Cl. rem 6ew ali et. 48 cnw it. ken n.w erh 47 .61 Cve haws m.6 wet er6 aenn aydi 46 .ayd bat cni haf nye per sow. sta tad wer 45 ard bak maym &et age ava 44 .sa ..d dep nhiy owld S£d skuw ta6 ark ?.. 43 .it ..ow crz kan lid net rawn twa amp anz erl 42 man n/iy 41 Ed. nEv nab abe aydow tyst 40 en? ga? gan tqk nit nayw rayd rayt anay aywt 39 art ind me6 Ptar yuwn a-? ariy ayga 38 -ke har i?w nan nEym 557 T A B L E S OF TRIPHONES 38 35 (COOL) (cont.) owst r.e Mr z.? an& awa 37 a? fre hiyr mays nn£ t.e ten wiyh 6ed •mz an lydi ant anh a?. aykft Eybiy tyka uwnow Tts 34 32 -lay .tuw .ayh fa& len m.ay nst rz. r&e ten tuk tak zar abc ami erf a?e ave ..b a6a bed inn luk m.h mba mEyk 31 nz. nam .di gtd nas 36 ruwm hiyz tab eda ism £r. tuw. ksa howm wi6 n.s lar 6am noww mis eka owwa mayk ani r£n ntuw anw rza nwa araw nym •tr ewEy sep tarn ?in sez we? tas 33 emt wiys bawt &en ama baw? atr arb arg bcyb ezi ayda das ayma gowz lygow 35 in. 30 .ha ktym daz m.s -na maen .St end mayf .Wl gat nin ..k hid hiyw t&a bal int wed Cer n£n z.w dem ir. nmay esk ow.w aena gan awta min rsa adi nts 30 27 26 (COKL) biyk (conL) ntys rst rz. S-? t.? te. &ek et Eyke ts. ear epe 01« ese •te am ant ayk. aylay eyha lyz. 29 En6 kal miy. nat nyuw r.a sayd Oruw 6a? e.w e.e emay enf erm aymz type 28 .biy -fa Emb fen hiys iks ins iqe las mEm neg ne& s.e sik sin siy. yuws zep &eh es. anw ly.e dit ded dad d£y. Ene EtS EZ. fii lak mam mz. mayd nd£y s.a t.a tep van wiy. wiyk ors elz en? er? ets ez. ats awt. aym. Eyks lyga 26 .de .haw .siy .er -ayg Eny fayv gad gra ISO iwa keb kuwl mtay miyn nis niyw rdiy sowft stay 25 .ray -ftiy ..1 d.e d£n deg dey Eks hiyk ite i?. may. muwv nd. nha r.w r.? rde rke swe tst wat wud wel or. eke el. ans aniy iy?e ?.? 24 .En .fa diy. f.. hiz 24 23 (COOL) (COOL) howl ini iss kud liy. m.a mOi m£yd miy. nayg ow.6 par an StE t.w tuwe y£a ude wan wiyd a.s enk apl aray atay aysi iy.? iyie lyen ?.w ?En 22 -hi Z.& ale d.? 6eg 6el deb fr£ any a?w gowt ly.a han isb 23 iz. .he ks. .?ow kte kat bel be? Ifys nliy dav Erw nnay hiy. ne. IIJZ ned kayn owpe 1.? rd. no m.e n.h sta wad ndi ni? wes nni wiyg nnow Jen nfti an. nel &ep pows e.h r.6 e.6 nyt eda soway elay tin em6 anm tray tar ad. tef at. tek awn. 22 (COOL) 20 .bi awnd -gow aws. .IE ay.. .a. aynow -ay. lyda .ays uwsiy a.. ark 21 di? dan -J» .an dar gar -ay« .aym g o w . hiyt -J aks I»« kirj bed d.w kriy kal d.ft d£y. kiy. har Ida kaz m.m m£n m.b mar mte miya mwe ntr nar nja nnEy nse nowe nz. nt. ow.e nayk pin owde SEV rum ske red stEy siz tel te? tet V" vam z.a Jiys zmay zan 8ny 6Eyh zeb a.b al. e.m Orow ediy ftef eha ekl are emE anC ewa ate ep. a?. epi a?t esi ayda art. ly.w ay.? tysa aygE lyfii ayne ayer 20 19 (COOL) (COOL) lyliy tyze arn awiy OdEy ela ang enEy epow eta eyuw ast ayOi iy.h lyr. uw&e 19 .EV -ow. -9 -t d.a diQ Ed. Eriy ESt cte fyuw gay. id. idi isg i/kit let Ifta lev m.t n.b niQ niz nowh nsow ntay nayt my. my. ow.? owte owz. ow6e pik rts rta skr sn£y tra tiyn tuw. t?e wiyz Jiyw yiyr z.b ar. 18 .ba ane de. Ere fEl gowe hiyg i8i k&a na? nlay nOi pan r?e stuw seb t£l tri tsiy tiyC uks zwe zye al& are 6Ey. 6iyz ed£y egi eha emb emiy enb ev6 ayki aynd THIRD GRADE 558 18 17 16 15 (corn.) (COOL) (cont.) (cont.) aysE iyw£y 7.8 he 6Eyk abi abc aday als aliy ems amw awda awt ayma ayt. nka nti naf nap nay. nayn nays ncyk ow.s f-V rd. rd£y red riyd ski sliy snow sowiy St. Stl t.b tev yes yuwe z.h oil oni Gin &0WZ btyr 6iye aduw age ahc show era aenh ayfa lysk lytay uwst ?ayw d.h diz Edi EnJ ghit ify isl kbi kiyp 1.« lowz Iz. Iza m may n.n ownn owniy pud qke red rit raek ram stl sow? stiy sor siy. siya tik ts. uka w£y. wiyae Jar zba zlay zriy a.k ela anl an8 asn azr ezs a6i 8?W aen/ awn. ayd. ayte 17 -huw .mty .riy .ayn btr dal dz. flrty inm IQI iza ih k.e kla ksi kftae kep kM liO liv liys m.d m.i n.y ndiy ow.h ownl own? put pal ra res rtiy riy. s.s slay t.6 tap vit wiyr /iyz yuw. yuwg zta Ol. ola £ V ? iV-6 lyin lyrz lysi ly&a iye6 ?it 16 -if -Pi .SE .t£ -31 .?a arm biy. biyf biya dsow diy. tnn 8£? gowt him ike izn kar ks. k/e kaet l.w Lb Iz. leyd liyp mm n.m n.ay IS -fay .ga -h£y .sk .way .eb ..a ban IS (coot.) 14 (cont.) sst SWl t.l the thiy towl tre triy tsi tte tan 14 teh tew .km uki .at vin .ayO win .?0 ..f wift ..r yuww z.k at. zgo ate t.. Zlt dye ze. dek zel tdr zem £n. onn gowd e.l gud ed. "tiaez ada hiy? afe efay id. em h ift en/ ikj inw epa erp irjg IQt erae ewi is. izh ezb azm kis krae aek. let aekt mayt any cqk n£k *?m nek aw?. niyd ow.y aywa OW&E £ydiy £yin piQ £yk. r.s rzow £ys. nyfl Cywe s.w iy.s sk£ lyfa £yda £yki lyku iyn. lyte lyem ?miy ?DI ?6e ?aym 14 13 12 12 12 11 (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) iyg£ tyso tyaed uwviy r.h r.k rbe rmiy ral ret raen riye s.b sbi smae spi sriy St. stw tmay tsw tayn V&l vbe wit Jiyzhaw eg edr efl egr elb em£y epiy asl asay et£ etiy ev. awiy ezl ezo e6i aykiy ay la lyki tyko lyne tyar uwel ?may ?eh .ri .ak nay h niyk n?. n?t ow.ae ow.ay owin owiq ownz as£y etEy avi azh az& aek. aesk ay.w ayd. ayduw aygow aymiy Eype ly.y lybr tykiy lypi iyz. iyzg uwm. uwwa ?-V 11 haep hawt 13 ,ba -br az .kr -nay -8r .ayk .aye ak. buk bayk dte dwe d£yw ta. Ell tie fio fol gowl idn im. tnh in8 Jem kil klay kliy kst ker mayg n.t nie ndr nday nfr ng£ nsk ntr nev naef naym niyt owhaw 12 owhty aw owze .miy ..0 ar? a?t base dmay dyuw dog d&£ d&e diys diyz duwi £nh £nm £nz Es. £&e £?t flf ftiy fayn gows hae? hiyd ikiy ild inz in? ISl isk itw kuwa l.s 1.9 Id. km lin lit layd layt liyn m.l m.n mza med mep nds nt. ne? piyp r.t rdz rga rh£ rim rni rtuw ryuw r&ae rak raep ray? sid sir) sit sli sowh saed t.s til tis trEy tiyv vek wEyz z.n z-y z&e zev oka ord ort e.p a.ay abl ed£ ehaw emo emae enp es. esp .ar -duw -ge -kt .ko .It ig- ik. iki ila irjo l?S Jer k.6 k£p kri kwe l-V lEy. luws m.p mar m pi mas m ay h ngow nma nmiy nowb now& nwE n&iy owjiy ow?e p.ae Pit p&e .naw -St -t£y ape p£yp Qk. are bal rhae bik rna bit rs. rye blae btyi rol dim rar dr£ raeo deh rfyn det riy. £9. riyn £9. s.6 sow/ fut faye son giv sot gowf sal gowaw saet h£l t.f TABLES OF 11 (COOL) 10 .fi .fr t-y tw£ -gr val -gay w£y. -I«v .lu Jip .la Ayk yar .ma .ma yal .n£ yes yuwd .na -tr Z.l -wa z.s zncy .ap .am zowl abh aid alz arb ats ÒEyg &£yw a?. bab a.y bar ebr emm bhow btn amò i£r apu ape d-i dig ap£y aqk dij dis 0SC dz. ath dayd ati adiy Etan. fam gen «im git «V. hawm aOr idiy a?6 im. ay.h ime ay .s aygr ima i ru y ayje aysa iqd ayen iqS isw Cy.e iz. iyJ iym£y izf 108 lyva lyaw 1?. kcl iy?. UW-? kid UWW8 klow kti ?l? kar ?syg kam 10 (coot) Ibiy Imay lya lEyi l?a m.f m.k mba mows m pa man mfta mar nfay nhi nriy ns. nta nza nOa n6a nah nayd niyh n?l owfa owm. owan p.a pta qga qin QZ. r.m rak rdn rfr rgow rik rnEy riys ruwò sgow smiy soww ttp no tayd tuwft vn vat wiy? 10 (COOL) I- yad yuw. yuwk yuwz ztuw zaw òiyow a.f aba abow afr ala apr apò ary ass asiy awe awa aya azg azj adi amp «may ant apa avò awnö awsa ayba ayku ayn. aysk ayt. ayts ayva ay?. ay?a Eydi £ym. iy-f ly.i lytu lyzb UW.6 uwer ?ha ?lay ?an ?aw 10 (COOL) 9 (conL) IQQ isr izm .key lOm i?n -pr .ah kla .aw ka? .a? lis adi Imiy ar. lowv bad lak bak Ian bla lay? bown l£ya brc liyg biyb m.g iik m.y Can mil mliy d.t dar mmiy dgow mpl dha mz. dray mayn daw n.f duw. ndaw nniy d?a Ediy nowz Elm ns. nan tip clt niyg niyl esa EVI niyz fra n?g fawn owl. fayr owna f£ys owwiy g£s ps. piys gai gays qks hi? qta howp rga han rip hat rk. hiyf ria hiya rmay huwz rnz iga rowz ijuw rpi ika rsi i ko rw£ tnô rzy rz& ini ?ayd Q y TRIPHONES 9 (COOL) reb rEyt s.h s.t Sil skw smay spay sad san s£ym t.h t.t thow tal tuwm udn v.. vi q vmay wak waw w£ya /«yo yag yuwm yuwt z.m z.t z.ay zhiy zmiy za? z?a af. an ÒEys a.t ab£y ads agay aka aki aka am? ana anr ar; atw azk azn azt 9 (COOL) azw azay a?b ami avi aez8 aw.. awna aws. awts ayka aym. aymg aymay aysa aysa £yba £ykft 559 8 (COOL) .ÒOW -a? .awt -I -P adiy akt am. ama arp blow bluw br£y bam bas biys bayz d.f tykty d.n £ymd dt£y £ymi daf £ynj deft £ywiy dawt £yan dayn £yar d£yz lydow duw. iy£n Eft iyf£ Eld lyja Ens lyka Epa En lyti lymf Ers lymay ES. lyn. E?. lynay fayt lyr. gowb gowh lysa lyt. gay. hil lywa lywiy hwa ?.h idy ?wiy ilz iliy 8 inj -bl my iqb .da iqh .d£ iqft -g£ .kiy isp .m£ iti .sn itk IVZ .sa 8 (COOL) iva izl ifta k.i k.s kuk kEyr kiy. kiyk l.h Lay lad Ibi lEf lown Iruw 1st Isa laym miz mayl maya n.i nak nd£ ndow nd6 nd? nsay nzr n8r naw nan naw. nay? n?n n?w owla owsa owap owat owawt par piyd q.a qki qar r.b r£g rga ns ne 8 (COOL) 8 (COOL) rki zown rlz zst rn. z6e rnd ZÒI rowl af. rowa aiq rwiy ak. ras akt raz als ras ans reyd any riyp ast ruwb az. 6£yd s-V s£k ÒEyt sin òiyf sgay a.a sk£y abay oài sma snay aia sow. afy spl air sta ama enj sa. t.r ana tfay ana tsa apa tsk arc aruw tsa tsò ató tsay at? twiy a?s t/iy e?t t&i e?iy t6a afa tan asa tuws at& ud. *?g udì awnn uk. ayga ukt aykt v.a aymi v£n ayma vtuw aymEy WlJ aypl wiya aypu Jud ayth Jiyd ayv. ayz. /iyh ye. ay?t z.l Ey.a zgow £ yd. THIRD GRADE 560 7 7 (coot) (COOL) cyme bay. Ika qan tya. taz lak ijen d.t r.f tyz. laa lyls dan liy. r.n m.r rtor dn. lyt man rdg iytt dra mfr day rgr lyal uwm. daiy mga ad uwtn daf mid rma ?.» dfc mpt rown rat mak ?.a da? ?di daym maa rftty ?tv diya mwE nyb ?now duwy mal ayw ?ab tla mat a.i £lw maw? a.k ?»P may? M t Clft 3VCI? miyt sa a 7 miyw aga tna £t& .an n.k air -baw •far n.iy atow gtô n£i aat -fli gin nfi aav .he .hw gow. nfa aaya gow& nha aty. -It gayz nif aiyft .1» gtyv ni6 t.n .ma nmi .mi ha. tgow .owk hayk nat tka tmiy -piy haya nai nyiy tat ida .ra nae tarn .a« igb ik. niyp tan .ta .tw imm niya taow ow.f tar .wu imt ina ow.m tya owl m t6f .01 inf -al ipa owmay tei ownh tayg .a* IQW owz. tfyl izg -ayf owzd tiyO •VP i?d k.w owzt tuwb -iy k.? ow&i uk6 a«. an6 urn. kag P-t arf ki? p.? vtr kra vah arn pal a?w kwi pat WLL bca kad payd wim wak bar lar IJ.I Id. q.a wayd bad Q.? wiyf bayft Idi biyt lu QZ. wiyl 8 (COOL) 7 (COOL) 7 7 . 6 (coot) (COOL) wiym wiyn wiyp Jat 1« y«ye? yur yaw yuwl z.f zht zha Zll zna zray zat ant aray aoi. Omay ayfe -ayj aymft .aya ayown aie aytô amg ayôe amiy ay?n ana fym. arg tymz at& fyat azi tyaa a?m tyt. a?a tyt a?6 lyar bowt braw lyfa tylb bawd lymd biyi lyp. biy6 lypa bay. lytr C.e tytuw Cil lyzn Siz d.r. lyzs lya. dgr dik lyat uw.a dowv uwgt dn uwgow druw uwl. dan uwyuw da? diyk ?.6 ?.ay ta. ?bi tda ?da tke ?gow tlz ?ow. flay ?owl ink tps ?aa ?t. trd tt. ?t6 fth ?6a tze 6 flay .bfy gid .dow goww gowa .ku -kay gtym .liy h.. .ra hap .ar hty. hiyp .0a .av iii .at lie 6IIJ 6ad 6iyay aba af. afa alow amaw amuw aqg arow aaow atp att azz aza e6iy ada ad& aka aka anb aa ash avt a?. a?a a?a awna aw?a ayda (COOL) 6 6 (COOL) (conL) imay int inj ipt irjn iQr ish ltd m how mme mowr mps mpiy mzi mel mem mad maws maya mtyh miyft n.t n.J n.r nda ndz nga nki nkl npl nsiy nwi nji nzd nayf nayp niyf niyv n?. n?b n?h n?ay U. Ua izi tal Jan J*Q Jiyp k.b k.k kdaw kmay krty kad kaa kwt kya kaa ka? kuww la I.I laz Its Ige Imow Iwe Iwiy lao lar l&t I6i lab lak law Ityg Ityn Uyz liye m.t M.J mdi mdaw mil mga 6 (corn.) rbiy rdi rtk rtz rfi rhaw rhay rla rks rka rmty row. ray rs. rak raay rt. rwi rzb rzw re. ref rep rev ruwe r?. S.I s.m sde stm sha ah at ska ska OW.l skaw ow.n ama owba sowd owfi sowf owkty sse owway swe ow/e swiy p.w sae s8i Pil pla s&a prt aawn siyn pay ped aiyw t.k pap qdaw tbe Qlay tdaw ttd r-J thi rbt 6 (eont.) 6 (COOL) tit ehi tiz ehe tlay ek. tsg ekr tuwO eks ume ekaw v.? ekty vga ekiy vwe elg ve. elu ved elw vea el6 viy. etty wal emf wan emk wep ept wayt err wiyt erv era ;-»y Jiyl esg /iym esa Jiya etn ye. et/ z.d ety z.r evm zdaw ezf zis ezy e?m zji zje abi zkr aba zwt adm zwiy adz zes ale ztyt am m aim ame alow anf amay ang anf an] anh ank arm ava arp avt arw awnt e. awar &tm aw?. 6e8 aw?f fttyp aw?t e.i ay.6 e.r aybcy ayfr eft efty ayhe ayin aga eh. aykd TABLES OF T R I P H O N E S 6 6 5 5 (cont) (cont.) (COM.) (cont) ayms ayn. ays. a yst ayti ayes ayev ayez eymaw eypu tyrtyta eytiy £yw£ tyal ly.b ly.k iy.1 ly.t tybe iyi. lyfay lygi lyhi lyhaw iyk. iyk£y lyld iyl£ lyll lylu lymi lypl lypu lyrQ lyre lytow lytey lyyuw lyzl tyzr ly&a lyab lycn uw.w uwba uwdi uwòa ?.b Par ?biy Piz ?t. aòi b.. ble bri bek ban baya Can d-y dag d£r dij dmi dal dawP dayv d£yn diyd diyg diyp duwò ?WI Par Pa6 Pa? PayPays Piys ayze jc .b£ -dr .fl .kl .nh -nò .my -owg -owy -pi -r£ -Sl -sp sty -tu -tiy -ed -af -eg -96 .aef .ayb -iys -UW. -?£y ..e aki alz an. and am UWlt ant uwke ar. uwmiy ary uwnz at. uwzt ath £-W £br fki £l. elf £ly £may £n£ Enow ena £viy tel fl« fet fay? gre gre gzgz gat hev has hawd hiyh hivl hiyl hiya huw. ids ifay igow igs igz il. ili llow imi inb ing ini mow ipipe iqa isd itb itm it6 izb iPe Un JtyJ k.t k.a k£r kfe kip kiz ksk ksl ksa kt. kun kyuw kfte keq kev kab kawt k£yv l.b Ian Ibow Ibe Ida ld& Idaw l£V Ife igt Ihiy III lie 5 (cont.) lowIs. Ite 5 (COOL) n?a ow.d ow.r ow.o owhow owka owli owmf ownow owr. owsE owtuw owwa owzb 5 (cont) rEy? nyk riyz let ruws 1er sar led SES lem SE? layi skiy lEy. smE Iiyd sowm liyv spow mad spuw m£k ssp mhiy sa. m re OWZl sef mam owòEy seg m&i oways ses meb seò P-6 m a w d p£n sawt m£yt phi sayz n.d pig siyE n-g pre suwz n.l t.m ps. n.ow psi t-ay n-p pu/ tdi puP tir n-J pen nal tía Q.h nba tne n£uw Q.Ò tnay truw ndy QiQ Qk. nda ttuw n£l tyuw r-g r.ay nfa taf rba nfe tbiy nna ttyi rds n o w p rfa tiynowv rfay tiyz nowP rgay tuwd rhiy npe ud. rif ukm nsp ntt ril um. rk. nwa ure nzh rl. uts nzi rna v.6 noi rpiy vse nayl rwa vye n£yh veb r/i nEyv rfli viys nfyw rab viyz waj niyn r«i nPk rayi wEe n?m wiz raya 561 5 5 5 (cont) (cont) (cont) (cont) (cont-) wayl /ik ehiy ekw elE elh elt emd emow emy epE ®rj erEy esf esw esa eta etb etf evt ez? eftE eftow eP. e?t e?k abs ad. akw aky ani anp anz api aesn avw awe a?d awmE awze aw?& ay.k ay.m ay.e ay.a aydaw ayfE ayfi ayhE ayk. aykE aykh aykr ayks ayky aylt aynl aypi ayr. ayny ayvg aywi ay6r ayem ayan ayiyt Ey-t Ey.w Eygow EyjEy Eymp EymO Eyrz Eyre Eyvty Eyflr ly.m ly-ay lytz lykl lykr lylg lynEy lyowl lyowj lyrd lyrs lyriy lysp lyta lyviy lywi lyzi lyzw lyOr lyes lyev lyez lyaf uwl. uw?e P.m ?.n Pan Pbe Pba Pfa ?gt ?gay Phe Phiy Pkay ?niy Powv Psc Ptuw PwE Pyuw ?Ai Pef Pes Pet Payh ayer al. aliy ams amy an? arti arr ata att a/aab a?k a?a bEn bil bme bruw bas biy. biyn biyz ÔIQ Ctyn d.b d.m d./ d.ay dbay dtb del dev dhiy d]a dnr dnt dn? dow. dowl dru dra dsi dse dwiy dze dayl dayw deyd diyb diyw e.. ebe edaw 5 /iyp iiy? yet yuwf yuwp yuwr yuwj z-g z.a zbE zdEy zfr zge zhow zkay zlEy zpiy zre zruw zyuw zze zal zflr zek zez zan af& aki alb alt an. an? ary arb ate a/iy Oru 6 as ÒEyl ÒEya ÒEye ebm eil ed. edow edt edy ef. afa agu 4A .am -ba -buw -daw -day -diy -fa -how -hay -id -I£ -ka -luw .maw -ow. -pe -suw .wa .wEy -ab UWSE ..UW ab. aCi uwzd a g o w u w e d ak. uwem a k a uwse UWWE 4 562 T H I R D G R A D E 4 4 4 4 4 4 4 4 4 4 4 3 (coni) (conL) (conL) (conL) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (com.) .own Egz ine Its nowi Qkiy syuw wEyt Oli e?ay aye& uwid clh i0£ Izi npr QSOW SOf wfyv olw a£e ayam uwin .owp £l£y iQay la. npu rjfc£ sol wiyo oie add ayav UWI? .owv Emi irl lei nre Oep seh /-y ol? adi Ey.h uwki -pu E ne isC laf nsn r.d sek /-e onm adt Ey.m uwli -po Enaw isn lawd nso r.o £rt ith l£yb nsa r.e « y sEyi /ed oniy af. £y.y uwlay -pa /al OQ. aeft tyg£ uwmi .sa Erk iti liyb nth ra| siyh Jet orf a]i Eyhiy uwsi -ta Erm ito liyw nzo ral siys y£ ork ak& EyiO uwtEy .ts £rt ivd m .a n e a rba s?e y£h orz anr £yje uwju -V£ ery IVI m.a nav rbay t-g y£ay ove ap. Eykm uwze -Ja cray iva m.O na? rdr t-J yin Ore aps Eymb uwef -J" est iwEy mal nawt rdae t.l yek Ò1Z Eymt uwet -OV esk izk mba nayfl rfa t-J yem bot are a n y Eymw ?.f .ad Ezh izow mda nty. rtu t.e y u w a &£yb as. £yn. ?-J .aw £?$ tad m£s n£yb rha tde Z.£ 6iy. asi Eynz ?£m .ayow f.ó i?h mowv nfye ri'z tfo e.d a s w Eytu ?fay .ayt ftl lab mpo Ï-I niyb rkl tfe z.ow e.E atf Eywu ?ke .iyt fis Hk mtuw niyr rnft ttd Z-J e.n ath EyJe ?le -iyz fio lap mwi niyO rnay town zba e-J avi £yol ?n. -?W fowr Jiy- mzay niyò rpl tpa zbo ebs awiy ly-g ?owp -?aw fny Juww m & a n?f rpe tsp zde abay a?b tyba ?riy ..aw fui k-h m a i n?i rsow tss z£n adb a?h lyC. ?Sl a.6 fyu k.m meg noyz rsw tsa zfe ed a a?n lyd. ?ti a.? fye kal ma] owba rt. ttr zga eha a?ay lydr ?er adow fòa kda m a w n owm. rtay ter zhe ehay awdi lydz ?6iy ai? fiyt k£n mawt o w m w rt£y tey zke ein awme lyduw ?e. akf 9 ? kik mawO own. rziy tea zmi e]e awnl iy£l ?ed akn alb fli? kiw miyd ownt ror teiy zn? ejuw awn? tyfaw ?ayl glae kray miyz owny re. tawt zowv elk awtb lykE ?ayv alow glay ksm miy? owp. rat tiys zpl eia aw?n tylf ?aye al& gowg kaow m ? m oww£ raev tuwa zru eluw aw?0 lymo ?ay? ami gruw kap n.o owyE r£yg tuwg zsa emg ay.d lyma ?£yt amay ?iyt ap. J aps har kjiy nbi owyuw riyg tuwh zwt enuw ay-y lymuw HE? kya nbl owzl riy? tuwi zzi esm ay-ay lynk hid kyu nba owzO ruwi tuwn zz£y esaw aybE lynz hie k£yk n b a owon ruwp tuww z6i etk aybay lyna .al hw£ k£yj nbay owal s.g tuw? zòa etm aydt lyown .bu ato har) l.r ndm ower s.p ukl zef etuw aydfi lyp. .bay a?b 1 arl atg hawk l.t ndw owayw sak utò zeg evs aydiy lyph .da a?f hayd lag ndo owiys sba u?. zeh ève ayfay typo -fow bowl h£yd Iba nduw ow?. abiy u?t zaw? ewu ay m tys. .fa bowr hiym Idr ngi ska v.m zayd eway aykl lyts -gu bowe hiyo ld£y p-y ngr pid sl£y viz zayg eje aykw lytw -g» bru huww ICS nho plow ama vte zayn ejiy aylb tyzh -ho bsi ife If. nhaw pri amuw veg ziyz ezow aymd lyzm -im bsk igd Ifi nhuw pso sows vep ode eziy aymw lyzp -I* buj igi Ihay nid pat spiy wal og. eas aynz UW.l bz. lif nkr -Jiy ila piyt srow wa? og. e?h aytd UW.S .la beb imp lik nk£y Od« ssow wig ogz e?ow aytu uw.a -lo bEys inp Ipm nkiy Qgow st? W1Q olf e?o aywu uwar -mow biyd inr lay nma qhow swa w e m olg e?6 aywo uwdEy -nn biyg T A B L E S O F T R I P H O N E S 563 3 , (COM.) 3 3 3 3 3 3 3 3 3 3 3 (cont.) (corn.) (coni.) (cont-) (cont.) (cont.) (cont.) (cont.) (cont.) (cont) (cont.) C-* El» gowr l/l Ila mtEy net pra rkr S.E the vze CEk ElE gow? l/t llcy mwiy nor) pra rk£y s.r tif vai ¿in ElOW g n l/W Imae mzh naes praw rkiy s-/ tim van tern Elv grow izd InEy mzr naw. psow rl. say tkr var Cat €IJ tmt graw izr Iniy mah naway psay rl£ sad tkay v£yk 696 gza tzs lowd mak naw? pt- rlf sai tliy viy. CEys Enp gam izw lows maer nayj pth rli sam tnow viye Cuwz £nae gap i9. maes naya pwa rln san towv w£m d.d Ept haj lat Ipi Ipl mayr nayae p6E rlay sd£y tr£ WEt d-J ErB ham Iray may/ nayiy peg rm. sfay trow WEW d.l tri haa »?g i?i Isow mEy? nEyd pam rmi sga tray wis d.p Ern haeb i?k Ituw miym nEyr pas rmz sir tsd wit dad Erp hae) i?l Iwi miys nEyt pav rn. sgEy tsh wowk dgay Ero haeò I«r Iway nan niyC paed rnn shaw tsy war dhaw Ub haw. Jowk nbr niym paek m o w si? tsfy wat diw ESW hEyt Itty l/i Izh nbey niy? pass rnt sku ts? we J dka Etb hiyb Jw Izk niiy n?d pEyn rowi snaw tyiy w a s dlay Etl hiyn k.d Izae ndb n?r piyk rowp sowk torn waw? dliy EW9 huwty k.f lag ndh n?6 piyn rpae sowl taep way? dne E/8 uae kam las nEt n?ae piyz rsh sowy tae? wEyd dow. EZW iba kfay I&« nfiy OW.E puwk rsr sowa tayw w£yk dowp £?. idow kma la? nik ow.k IJ.S rsiy spa t£yb wEyr dowt E?E idz kmiy led nip owbay rt£ Sp£ t£yd wiy. dowz f.ae if. kna lam niw owbay qg£ rti spa tcya wiya drow f.? ifh kowt l«P nia owdi og> rtr s p a tiy. wiyj ds£ fba if& kra l«J nji o w d u w qhae rtw sru tiyk wiyow d/iy fCi tga kruw 1«? njt owgr rjkl rto sra tiyp wiyj dza fhiy igh ksf lawt nlE o w h u w qtr ruk ssk tiyae wiyy dam fik ifll ksw lay- nil owit qtuw rva ssae tuwp Jin d&iy fiz igw kt. layb nlu owlb QWl rja ssay tuwj Jiz de. flEy lib ktl layv nluw owlj rjwiy rzh stb tuwae /i? daet fluw ilk ktuw lEyy nmEy owmr rjof rzn stm t?. Jow. qbe dayp fra ilm kwiy lEyz nn. own. QDI rzt s/iy udh ;«k days ft. ily kóiy liye nna o w n i qòa ran sye udm Jiyb dcyh fwe imb ka. luwm nnd owowv raij sam uds Jiyf dcys fwiy ims kaes luwn nown owp. r-P rftiy ser udw Jiya d£yt fek ink kiys luwa nows o w n rad rag SÒE uk. Jiya d£ye fai ip- l.m l?ow noway o w s w ram raw Sòl ula Juwz dEyae fam ipiy lat m-J npEy owt. ran re? sòae umi yus dcyay fayd la? ma. npiy owya raq raeé saek und yu? diyh fayk iQf iQm Iba mbz nray ow6ae rbl rawl sEyò ut. yah diyt fiyd IQ? IbEy mbay nta o w a m rbu ray. siyi utb yap diyy fiyl irk lid md. ntk owaz rb£y rayk siym uja yea dtyay fuwd isl l£m mEr ntn owaw? ri. raym siy? u/iy yuwa duwt fuwl tsv lEn mhae ntow owtyd rdb r£yv t-d UZl zan duww 0 - * i se ler mlay ntu owiyg rdl r£yz t.a v.f zar dUW3 ga. ItE IE? mmi ntiy owiyw rduw riyr tak var zbi Eds gbi itf Ifr mpf nzt ow?ay r£r ruw. tba vfa zbl Edt gio HI Igu m p m nzae P-b rfb ruw. tbiy VI? zbow Edw gla itt Ihow mray nor p-ay rfu r?n t£m VZ. zdE Edz itiy gii g o w o w it? li? ms. not pifi riC raya t£6 VZl zdow Ikl msow n6ow pmiy ri» s.d tfr vzm zEr £9 nam 564 3 (corn.) zfa zfay zg£ zgay zhi zid Ut zJEy zkl zlu zla znow znay zra ZSl zsk zsow zzm Z3f zaeb zaat zuw. adi ah afa ok. Ok» onk ana arow ore ar? at. avi awi azm aza azay aba e.b Sal Sat Oad 6am Oawz bEi 6i? bin bow bai baz THIRD GRADE 3 (COM.) bsym bcy6 biya •.a •-I a.e abu adb afu agi ago ah. •Ii sk. akb aid alf all aln alj alaw amn amr anaw eph aps aoa esb atj ata avf avg avh evy abcy asm aan aan aiyt a?l a?n abz aefC aega aha aki akr aem. ami ana ana ap. 3 (cont.) as. asr aas atl awn ®Jk a/t az. azl abi aw.t awd. awka awniy awsi awtt awwa awaz ay.g ay-I aybi ayba aytr ayfu ayhi ayhfy ayji ayka aylh ay m h aypa ayaty aysiy aytow aytw ayto aytay ayvi ayvm ayva ayyuw ayOa ayal ayat ayad ayaf ay?w £y-i Ey.k ty-l Ey.s Ey.ay 3 3 . 3 (corn.) (COM.) (COM.) Eyd. £ydh cydn Eydow Eydz Eydaw Eyduw £yg. £yor £yk. £ykd £yku £yi. tyli £ylz £ym£y Eymiy £yna eyr. £yrm Eysb £ysi £ysk Eyat £ysiy £ytuw £yv. £yvt Eyvy Eyji £yb£ £yap Eyaen Ey?b £y?k £y?t iy-I ly.r tybl tybay lyfiuw tyda lyda lydaw iy£r lyfi iyg£y lyk. lyka tyln tyla lyl? lyme UWWl lynd uwz. iyn£ UWZ1 tynm uwol lynt uwbi tyniy uwah lypr uwap tyrb uwav lyrk uwtyr lyrw ?.d lyray lyaow ?J lytiy ?.k iywu ?.t lyya ?al ?am lyzj lyzt ?if ?im lyza ?ki tyz? ?ma iy6a tyag ?ma lyap ?maw lyaa ?nn tyav ?own lycz ?ray lyayd ?s. lyayl ?sm lyaya ?sow iy?d ?say uw.b ?ta uw.g ?tw uw.t ?tay uw.y ?wu uwd. ?ye uwda ?ak uwduw ?ad UWEV ?af uwfa ?at uwga ?a? uwha ?ayf uwlb ?ayn uwld ?ayt uwlz L uwm£ uwma .ak uwma .at uwmay .a? uwn. .bow uwn. .bay uwpa .fii uwtuw -i£y uwvt .dy 2 2 2 2 2 2 (cont) (COM.) (COM.) (COM.) (COM.) (cont.) -d£y -Er -fy -faw' .f£y -hy .fuw -g£y -10 .]ow -ks .kaw .mm .ma .muw -ng .ns .nw .no .na .n£y .owb .owt .oww .oway -P£ .ra .row .ruw .sm -SW .say .tow .wow .wa ayr -lya -iyuw -?n .7t -?iy .?uw ,.z a.s a.t a.w aba a£h ail aCt ada ado aday af. ag agn agz aga agiy akb akb aka all all aim alp aly ale ama amt amw amz an. an£ anf anh ank anl ann anw apt apb aqg arC arl a row ars arz asp atd atm atw atuw at? az. abty aak b£t bid blaw blay bowiy bsa bag baj bas baeq baw. bawn bay. bayh bayt bayw bay? biyh biyw biy? bayn bays ¿.ay i£n Cla ômay Stiy iab iev Caw ¿uwd d-8 d.O da. dah dam dba dda d£d d£m d£8 dfi dfa dfa dhi dih div dk£y dli dma dn. dng dnl dnow dns dna dniy doww dpi dpa dra dst ds£y dtuw dum duz dwo dzi dzw dOr dbEy deC da/ dae daev day. dayg dEyb diyf diyow diyr diyb diya duwm duws duwa du way E.b E.ay E-? Edh Edk Edn Edu *0Egy Eh. Eh. Eha Ek. Ekt £kj £la £lb Eln Elr Ela Eliy Em. Emg Emp Emiy Enj Erb Erow Err Er? £»y Es£y Etf Etm Eta Ear Eayh £?d E?b £?e f.w f.ay fan f £J ffa fin fir fla flaw frow fsa fti ftuw fb£ fad fas fayf f£yr f£yv fiy. fiy? 8-d g.a gan ga; gaa gbl gbr gdi gda ah gha gim gluw gni gru griy gwEy gye gal 9£yl h.h h.a hal has h£v hft hm. hows hal haq haee haw. h a wow hawj hawz hawb hawa haway hay. hay. hayb hay£ hayn hEya hiyi hiyow hiyy hiy6 huw. huwa -/£ Juw -ya -yn .yow -ay .88 .auw .al .as .awd .awa .ayr .ayv .ayy .ay? ayk 569 T A B L E S OF T R I P H O N E S 2 2 2 2 2 2 2 2 2 2 (cont) (cont.) 2 (com.) 2 (cont) (cont-) (cont) (cont) (cont) (cont) (cont) (cont) (cont) IZ? kan kav ka/ k9i ka. ka/ kaay ka£ kaf kart kar kacv kaw kawb kawC kawd kawg kawn kaw? kay. key. key. keyd kiyi kiyw kiyz kiyO kiy? I.a I.E l.f lag Ibc Ibay Idb Idg Idh Ide Iday Idiy Iduw Ifo Iht lip III ijiv Ikow Ikay Ila llaw Hay lowl loww Iowa Ipa Is. 1st Isp ISO ItItr Its Itay Iv. Iva 1/l/a lyi lyuw Izm Izr Izw lof loi Ian lòcy lòiy la. laws laww lawa layl layn layw leyh leyk leym leyt Icya liyh liyi liyk liyr liy/ luw. luwi luww l?l ma. md. mda mfa mfa mgc mgl mtya nzk mgow m?a nzy m?a mhi nzz mhaw m?ay nof mtk nam nov now mim nba mkl nbc ne. nbiy na. mka m key nboy nak nat mna nò. mowt nCm naww mowò ndt nawa mp. nawiy ndj nayr mp? new mny nha neys msn nhay niyl ni. mst niyay nuwy msey ntb mtu nim nuw6 m to njd n?s mtiy njiy n?iy mjiy njuw ow.a nko mya ow.b myuw nla ow.g mzb ow.l nla mzm nmo ow.p mzow nno OW.J mzw nowd owba mziy nowf owbr mOr nowl owbo m6a nowr owbiy m&£y nowt owd. now/ owdz ma. maw nowaw owdò maz npa owfay nro owga ma? maf nra owge owgay mag nsf nsw mat owha ma/ nsey owhi mayow ntg owid mayw ntm owik owk. mayy ntw mayiy ntf owks meyj ntò owl. owla meya nta owlf miye ntey miyf nwo owln miyi n/a owlw miyl nyow owlz miyr nza owie miyy nzb owlò qruw QSt qwa Ozi •za qab qal QSS Oayk q?a r.e r.l r.ow r.r r.aw rab rag rap rat rbay rèe r£i rdh rdm rday reb rei reo ret rea rfa rge rha rhow rhuw ri. nb ri? rka rlkrlow rm. rme rmow rmo rmuw rne rny rna rniy rowd rowh rowv roww rowò rpr rpy rray rruw rsl rsn rss rsfl rsey rtm rtn rup rvey rwey ria rzd rzg rzi ni rzk rzl rzm rzr rzz r?e r?i r?m r?p r?t r?ey s.a s-I s.n s.ay sbe sbu sba sba sbaw sbay SÒ£ sia sde sdì sda ser set sfe Sfl sfa she show shiy sim sìa skh skl skt sky skay smow smey sn. sna sniy sowb sowi sown sowp spu spey sray SSl ssl ssa ssey l.h 1.« IÍ. its ida ide idg idk idt ida ifi ifw ifa 18 ig» iQk igp igr ig? m ikb ikow (1. ilt ilv im6 imaw imiy inaw i nay iney inuw irja lOiy irs iry tra isj l SD IS? It« IV. i/a iza i it izy 1ZZ IZÒ iza izay iziy iziy 103 lOw IÖO i6. i&a tan lar i?b i?m i?r I« It? Jim I« Ima Iowa I»e I«yjeym Jiyn Juw. Juwi luws k-g k.l k.n kj k-y k.ay ka. kad kba kba kday khi kha khiy kiS kla kow kowl kre kra ksb ksc ksò ksay ktaw kul k/ow kad owlay PI? owme play owmt pliy owma pm. owng pmay owne powz owna pray owpw psa owr. psm owrb psr owray pti ows. ptuw owsa pul owsk pwi owtn pya owtr pah owve paft owwt pa? owwawpa? owzp pawa owzr pay. owzo piyiy owza puwl owzaw puwn owol p?m owaf payz owas 0-d owaw q.w owan Q-e owayd q.aw owayg gbey owayk qbiy owayp qdi owayt qek owiyz Ofi ow?a ogz qhay P-9 p.h qid Qlt P-i p.l Qi? qkr P-r qkw p-s Qko p.3 pat Oli paz qmiy pba qna pdi qnay pda OQi QQO pes pfay 00® pib ooay pim qra no ram ras raw r«. ròc rah raj rau raw raz rayg rayv rayw rayz raye reya rcyb reyk nye riyf riyy riyò ruwn ruw2 566 THIRD 2 2 2 2 (conL) (conL) (cool.) (com.) Stl stn sts sty tei tec teO tab tawn taye «VP t£yr t£ys ttyj tcy? tiyf tiyi tuwf tuwt tuwy tuwz udc udf udg udk udt udft uda udiy ukf ukk ul. ulf umaw unn uns un? upurb use ututd ute ut? uze uen v.b v-J v.w v.y vdi vdo vde vgr vhi vik vll viae vmi vmiy vowp so. SOI SOS se. saw sa? say. sayc sayk sayw sfyn siyb siyd siyz siyay t.v tam tan tba tbi tbl tbay tdow tck tew th£y ti? tkc tkl tkD tkcy tla tlu tlEy tmty tmuw towp tpi tpl tra tro tsb tsf tsl tsaw tts ttay tup its /wi /am /es /ev VSl /C yr Jiyn vtiy vya Jiyt vzr /iyô V3W Juw. vOi Juwt vflr yae vew ycb y£l val viyt y£t yha v?e W-? ynow w£J yows yoww wip yrb wir w o w w yar wul yej wum yej wun yez wu? yea we. ye? weg yad weh y«f yuwh weO yuwiy wet wag yuw? wawe z.p way. z.aw z.iy way. wayy zbu waye zbay w£yf zbiy wtyb zbay wiyty zd. w?e zfa waye zfu /-w zfcy zim /-/ ziz /.a Jad Zl? /ar zka zla it r zlow JtQ zme ik« zmaw Jlay Jowd zm£y zne Jti 2 2 GRADE 2 2 2 2 2 2 (corn.) (cont) (cont.) (cont.) (cont.) (conl.) (cont.) (cont.) zniy zowd zowp zn ZS£ Zt3 zwa zjuw Z3W zed zefi ze? zad zaf zawt zay. zaym zcyw ziy. ziy. ziyh ziyi ziys z?o z?a 3.6 0-8 3~ sfa 3lt ala sir ala ala oliy 3mh amm ame amiy anj anp any 3Q. aijt arb ore ase asiy ots stay av6 afte ael aer aes tin Oba Oday Ois Oit 8iz 8miy Owe Oeb Oen Oaw? 6.w bar &£h 6£w 6riy 6ruw 6ey ban 6ey. »£yi 6iya ftiya e.ow e.3 ebz ebuw e££y edf edg ad h edk edl edm edp eff eft efw efa efuw eg. •Iejm ekt eku ekay elp el? eml epd epn epw xmd amr an£ an8 xnaw an£y apn apt aqd asa asa ate atk atn aetow aetw ata at? aeun avf avm ava av? a/I azf azs aen aah a?f a?i a?ow a?y aw.y aw.6 aw.a awbay awit awl£ awnb awnh awnw awsn awsw aws/ awtf awth awtuw awz. aw6e awbfy awe. awed awen aweb awtyz aw?l aw? m aw?ay ay.£ ay.f ay.i ay.l ay.t ayda ayd£ aydl aydn ayds aydw aydz ay£n ayfa ayfiy ayga aytz aykg aykm ayka aykay aykfy aylaymb aymf ay m m aymn aymt ayna ayn£ aynh aym aynn ayns aynt ayny ayr. ayrd ayri ayray ayruw ays. aysm aysow aytp aytr aytt ayt£y aytiy ayv. ayvy ay/e ayya ayz/ ayze ayed ayek ayeq ayas ayuws ay?ay?m ay?6 £y.a £y.b £y-J £y.n Ey.r £y-6 £yb£ Eybi Eybow EybEy EydE £yda EydS Eyfr £yk£ Eykf Eykn Eykw £ykaw Eykiy tyiEylu Eymm Eymow £ymae Eyn. Eynn Eypr Eyrg cyr/ Eyny Cyr? Cysw cyti cytm Eyts Eytt £yty Eytcy Eyvk Eyvow Eyvr Eyvz Eyve Eywa EyyE Eyz. Eyzi Eyzm Eyzy Eyza Eyze £yan Ey&a Eyeb Ey?e ly.n ty.p iy.D lybc lybi lyba tydE iydj lydw tydft iyd£y iy£v lyfl tyfow lygu tyge lygay lyhow tyhe tyhay tyit iyji tyla tylh lylk lylr tyit lyly tylz lyla tylaw iym. lymb tyna tynb tym lynl tynow lynr lyny lyn? lyowp lyowiy typa lypw typa lyri lyrm tyra lyruw lys. tysm tysr tysiy lytd lytf lyvz lywow ly/e lyyu lyyiy lyzd lyzf lyzO iyz& tyzay iyaf tyan iye. iyfl iy&£ iy&t iy6iy lyed lyef lyek iye? lyaw tyawe lyay. tyayw iyaye lyiy. BQl ash etu etay ev. eva evd eve evl evw eva eva ev? e/i ejo e/a eya eyu eza ezd ezc ezp ez£y ezuw eflr e&a ee. eel eays euw. e?a e?£ e?g e?; e?a a.. ab. adf adow adw ads aday agn ahf akh •kj akiy all ama TABLES OF 2 2 2 (coni) (coni.) (coni.) (coni) ?af ?ar ?3W ?6o .kw .ky .Ih .low -ley .m. .mb .m? -nb .ni -nj .ni -nj -ny .owm .owa -owiy .owuw -OW? -PS -pay .puw -pay -Qi -ra -r«y -sg -sh .su .se -tD -ta -tay .toy .um -va .yh -yi .ys -yt .yu .yo -yay -yiy -Zfl .zi .zw .za -za -Of lyuw. uwzae uwan IV? uwOb iy?iy uw.h uw6i uweb uw.J uw.ay uwes uwbi uwoz uwbr uwad uwEn uwaf ?.a uwfi uwfr ?.l uwgr ?.ow uwha ?au w i m ?ad UWlJ ?bl uwkj ?bay uwlm ?daw uwliy ?fr uwma ?fe uwmt ?flr uwmw ?ge uwmz ?hi u w m l ?iw uwmcy ?Je uwnt ?k£ uwna ?km uwniy ?k£y u w p . ?lu uwps ?la uwpu ?m. uwrh ?ma uwsk ?mi ?n£ uwsl uwsp ?nm ?nz uwt. uwts ?na uwto ?ne uwv. ?nay UWVI ?ow. uwvm ?owy uwve ?OW8 uwwu ?piy uwwaw?s. uwwiy ?sp UW/l ?st uwya ?sEy uwye ?siy UWZE ?t£ uwzg ?tl ?tm uwzj uwzw ?tt uwzò ?/a ?ft£ ?6£y ?eg ?ey ?ab ?am ?aew ?«/ ?awt ?awe ?ayp ?ayr ?£y? ?iyl ?iy? aynt ayzii .a. .aa .ad -ag .ah .av .Ce .Ca -Ek -El .Em -EQ -EZ -f£ .fu gì .ha .hm .hs .ik as -IV .i8 .iò .19 -lu -Joy .km 1 -DOW -DW 1 (com.) 1 (conL) aid ais aCw aCft ae? ad. ad. ad£ adf adn adaw -xk afd -3EZ ag. .aò aga .«a agay ahm .cay ahow »y .awE ahy -awh ahfy ahiy -ay. aim .ayi .aya al-•yay ai.ayuw alb -Eyt aid uyò als akd -ivi ak£ -lym akh .lyw -iye akl akw -iy6 -uwuw ako ak£y .?b -?h akiy ak? -aya al. -Q ..ay alg alk a.b air a.d a.f alay a.g aluw a.k am. a-y amd amk a.a amm a.a amow a.ay amp aa. aaa amO amey aan aa? an] ab£ anay abty an£y -aay -li -03 .6« -0aw -Ouw .6b -òr -•0 -eh TRIPHONES 1 1 5ff 1 1 1 1 (cont.) (conL) (cont) (cont.) (cont.) (cont) aown ap. apa apb api apk apa apty aoai)b aok aqw aqò 8Q8 ara arv arw art) arft a ray ask ast ata atb at£ atf atk atl atow ate atiy au? ava alali a/e aja ajiy az. aziy aOi ae. ae. aeh aan aar aav aa? aay. aayn auwn a?. a?E a?g a?h a?i a?l a?p a?r a?v a?/ a?y a?aw a?ay b.b b.k b.r b.e barn ban baò bauw bdi b£l b£0 bga bif biw bi? bliy bma bmay bpa bra briy bst bui bzg bzi bzn bza bz? bad baf bak bao bat bef bah bai baw baft baa bag bal bar ba? baw. bawz bawò bay. bayf bayi bayl bays bayO bayay bayEy bEyg bEyr biym biyp biyr biyv biyy biye biyay biyty buw. buwb buwh buwm buwn buws buwe bayf bayi bayw baye e.b C-i C-I 6. s C.w t.b a.? Cap Car ¿a? ebiy íde ¿di öde ¿ES öEe ífe ega ¿ha Cha Cid íis íiw eie Ci? eia ei« (mow ¿nay epa Cay esE esk esay esuw eti etò eta evd ewi £we eyi eei tbt eò ow eòe Ced Cef Ceg Cep ees eee Ce? Cayw Ceyr Ciyg Ciyk Ciys eiyz Cuw. Cuwn euws euwa C?e Coys d.E d.a d.aw dal dak da? dba db£ dbr dbu dba dba dbEy dbiy dea dey dCEy ddg ddi ddp dda ddsy dE. d£a dfa dfr dfa dfay dfiy dfuw dga dgi dga dhuw di. die dif dir dia dji djò dia dka dki dkr dka die dlow dip die dia dma dm£y dmiy dmuw dnd dnh dnm dnn dnò dna dnaw dowf dowi dowm dowr dows dowe dpa dpr dpu dra ds. ds. dsg dsk dsm dsn dsw dsa dsay dtw dta dtay dun du? dve dvEy dwi d/uw dy£ dzb dzd dzh dza dot dav daw die dei dòr d&a de] dak das daw daz daw. THIRD G R A D E 568 i (coot) dawd dawm dayh dayt dayk dayr day« dcya dcyp dcyr dtyi dtyb dcyiy diya diyC diyt diyi diyl diym diyn diyv diyuw duwd duwt duwh duwn duwty d?a d?ow d?ay E.d t.f M C.I t-y t.6 t.a tab lb. tbi tea tda tdf tdg idj cdl tdm tdp td» cdcy td? tt. 1 1 1 1 l 1 1 1 1 l 1 (coot) (coot) (coot) (cont) (coot)_ (coot) (cont) (cont) (cont) (COOL) (COOL) Un tfb eft tfa tgh tgi eg* tha ttu ftw tti tty ttty ttuw ft? gun guj gua gwt gzb gzt gzk gzp gzz gza gôi g6a ga. 8» gad gah gat gaw gaz ga? gayh gay] gayl gayr gay/ gayo gaya gaya gayay gtyt giy. giyh giym giya guwn guwty 8?» g?iy gayn gaya h.d h.s h.t h.w h.y h.? hab haf hak hat ha? ht. htr htw hta hhow ht. htg hliy hmt hmm hmay hna howb howd howh howk howz hat haa huk hya hya hyuw hag hon haa he. hal has haz haty ha. hah hawt hawty hayg haym hayay htyg htyl htym hfyr htyw htyy hty? htyi htyj htyty huwe huwt huwg huwh huwt huwk huws huwj t.a uw ib. tba tbr tbty iC. iCd tei i et tCw tee tea teay idb tdh tdm id/ id& idaw tday iff ifr if/ ifaw igt igg tgm igt ihi ihn i haw ihiy •Iike ikf «kg ikl ikt ikz ika ikaw ila lit ilg tlh ill ill ilp «J lal tvt tvt tw. fayw fayy fay« faya ftyk ftym ftyt fuwz fuwa fl-b g-h 0-1 g.ow g-t g-w B-e g-» g-ay gai gdow gegtv gta ggl ggow ghow ghy ghaw gir giO gkr gka gib gma gnaw gnty gowa gowm gowv gowO gowa gpi gpuw gra gai gak gal gap gat gaa gta gtty ilu ElW f.d f.f f.h f.t f-J fad fba fda fda fta ffa fiuw fkt fka fka fla fit flay fma fow. fow. fowl fown frty fruw ftf ftk ftl fty fu? fway fjt fjty fyow fof fan foe fD? fbty fbiy fa. fag fap fav fay fan far fat fa? fawt fayfayt ktj kia kjiy kki kka kka kkty kit kli klEy kluw kmow kma kma kmuw knaw knay kown kpi kpa krow kse ksg ksn ksr kss ksy kse ksiy ktd kth ktm kts kta kta ktty kum kut kuz kua ku? kwow kwu kwa kwa tkk tkw CkY tie «H tie tlaw tm. tma tmt tmf (mm fmr tma tma tm? tnb tne tnl tpb tpd tpf tpp tp6 tpa tqg tqk tqw tqft trl ira tse tsm tan taow taa taS taft taay ta? ttd ttg ttl EV- EWE Ewl twm twu (WW (way twty tw? t/i tjiy tz. tzk tzm tzp tzr tza tzz tz6 tzay £6» tad tag tah tan tat taw taft taay tat Eayi taym taya £iya t?a t?h t?m £?n t?p t?w t?v t?a llw ila tie izp izt IZV lift ill ilay ilEy il? tmg imn imw imz ima inv tna IOWW tpt ipm i pu ip& iqow IQp iOy irg irt irz isa isf isow isy IS& isa isty itg itn itow itr itu lOb lOd lOg i6h i6k itj i te itty IV. ivb ivm ivr iwt IWl iwaw i/a iJY i/e i/ay i8r iey tOaw l&i iM t6aw iftiy la. lab lav laz layh uy. IUW. i?a i?f i?ow i?y i?& i?a I-h I-P I-a J-e I- lar Jba Jdi Ida Jdiy Itf ici Itn HQ Ht Jnay low. Isow Mr Jus Ian I®* la? ]an Jtyd Jtys Jtyw Jtyz I«yIiyl Jiyn Jiyiy Juw. Juwd Juwg Juwl Juwn Juwv Juw/ Jayn k-I kae kas kat kaz ka? kbl kbow kbiy kbay kea kda kdn kdow kda kte ktk ktv kt? kfl kfr kgi kgow kga kgty kht khow kha khaw khay ktf kim k/i kza kzay kaf kak kam k6ow 560 TABLES OF T R I P H O N E S 1 1 1 1 1 1 1 1 (cont-) (cont.) (COIIL) (cont.) (cont.) (cont) (cont.) k6? k«e kaf k«h kaw kay kap kat kat kawz kay. kayd kayk kay» kayw kcyl k£yn k£yp kíys kíyft kiya kiyb kiyd kiyh kiyl kiym kiyn kiyt kiyay kiyiy kuwd k?i k?a k?a 1-9 l-I l.n l.ow l-P IJ 1.9 i.e l.aw l.iy lam lap las lau laa Iba Ibr Ibay 16. ICty Idf Idow Idt Idw Idy Ida Id? Ifk Ifl Ifow Ifs Ifu Ifae Iga Igow Igay ig«y Ihi Iho Iha Ihuw li. lib liw Ha IJuw Ikd Ika Ika II*. Ilow Ib lis lliy Im. Imi Ime Ina Inow Ina Ina Ina Inaw Inay low. lowl lowr lowy low6 lowiy IPIpu Ipay Ipty Ir« Isl Ism Isn Isr Isw Isa Isiy It. Iti Itu Itw lt£y Itiy luí lum Iva Ivm Ivay lw£ Iwu lw£y IJ" l/ow IJ» Izd Izt Izg Izl Izow Izt izy Izo Izaw Iziy Iz? lat Idv low lOty Iftow laf lag lal lap la/ laz i»e lai lat lal lae law. layg layp layz laya laya Icyc l£yf l£yj ityo l£yw ley? Iiya liyfi liyc liyl liym liyt liya liyft liyaw liyay liy? luwb luwd luwz luwft luwaw l?£ l?a lay. m.ow m.v m.aw m.iy mah ma? mb. mbi mbl mb£y mbiy mdj mdm mdow mdt mdw mda mda me. m£v me? mfl mfu mfa mfa mga mgr mgay mhm mha mhay mit muy mi? mkt mky mía mm. mma mmh mma mma mna mnt mnow mna mnuw mowd mowk mowm mowz mp. mpa mph mpu mp& mrow mruw msa ms£ msi msl msp mss msa mti mta mtaw mwa mwu mwoy myow mza mz£ mzf mzj mzk mzl mzn mzp mzy mzz mz6 mzaw mof moa m&£ m&ow ma. maf may mak maa maa ma? may. mayC mayl mayp maye meyb meys mtyft miyg miyk miyp miya miyfl miyay muwn m?i m?p m?a n.a n.v n.z n.e n.uw na. naa nad nah naow na/ naay nbow nC. nid niv n tb ndd ndg ndp ndí ntf ntb nfl nfa nga nh£ nhw (conL) npay nra nr£ nru nrty nsh nsm nsz nsaw ns? ntb ntd ntp ntt nty nt? nup nvi nvay nwu m6 nway nih n/a nil nj£y niv nya niay nym nyr "Je njow nzc nju nzf n]6 nzg njey nzj nzow nka nk£ nzs nku nzw nky nzft nz£y nka ni. nam naa nía nía nlty nm£ n9s nmaw nOay nmuw n6. nnb naj nng nay nnh naz nai nnu nnaw nad nowt nal nowm nap nowy nar nowuw nanw na/ npa npo naz 1 1 1 1 (cont.) (cont) (conL) (conL) nawi owcn owsm owaym nawm owfa owss owayO nawn owfey owsa owaya nawr owfiy owsiy owiy. naws owgow owsuw owtyfi naw/ owgu owt£ owiyf nawy owh£ owti owiyl naw& owhw owtt owiym nayb owha owtw owiyn nayi owhay owtaw owiyt nayu O W l f O W V l owiya nayv owis owvay owuw. nayy ow]ow oww. owuwh nayuw owk. owwa ow?. neyj owk£ ow/s O W ? l owki owyi ow?ow ncyl neyp owkt owzC ow?aw ntyy owku owzf P-f ntyO owlk owzg p.n n£y? owlt owzh p.e niyi owlaw owzn p.aw niyy owliy owzs pab niya owma owzw pak niya owmm owzy pal niyaw owmomwzz pan niyiy owms owzd pap nuw. owm/ owzuw pbr nuw. owma owaf pbu nuwb owma owOd pee nuw£ owm? owOr píe nuwh ownb owOs pda nuwm ownc owOw ped nuwn owns owOuw ptg nuws ownw ow&r P í k n?í owns owa. Ptt n?£ owpa owab P«J n?y owpi owad pfw n?£y owpn owag pfa ow.4 owps owak pfa ow.J owpt owav phow ow.t owpO oway pha ow.aw owpaw owaft phay oway owp? owa? PU owan owra owaf pir owar owrt owawmpis owbi owrn owawiypiz owbaw owrp oway. pka owd. owrs owayb pli owd£ owrz owayf plk owdow owra owayh pluw owda owraw oway] pmi OW£l owsl owayl pml 570 1 THIRD 1 1 1 1 1 GRADE 1 1 1 1 1 1 (cont.) (conL) (cont.) (cont.) (conL) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) pme pn£ pns pnt pne pniy ppa pp£ ppi prow pro pr£y psd P»k pst pse psa psiy pta ptb ptm ptr Ptt ptaw ptiy pur pus pwa pwiy pyuw pom par PDV pae P«i p&i pfta peí pek P»Q pez pea P«e pawn paypayl pays payz paye p i yd ptyf p«yi ptvl ptyj ptyy piyb piyfl piyow piyr piyy ptye piyuw puwr puwz P?i p?e payn 0-b o-f Oowv opi Ope rdi rdd rd£ rdf rdl rdk rdow rdp rdt rdu rdw rdy rdD rdaw r£w r£iy rf£ rfl rfow rfiy rfuw rfll rgu rgay rhw nh «I riv nw rie rja rjuw rkf rkow rkt rka rkaw rk? rid rlh rll rip rls rlt rla rlfy rliy rma rmm rms rmw rma rmaw rnh rns rn8 rna rnaw rnuw rn? row. rowb rowf rowg rowk rows rowt rprpa rpaw rpay rr£ rri rru rsa rsb rsg rsp rsb rtg rth rtk rtl rtp rtu rvd rvi rway r it rjiy ryu ryw rya ryiy rz£ rzf rz2 rza rz? rof roi rok rap rty r®r rf)w r6o r6aw re? r&i reo rej rae reaw raea rad raf rag rae6 rawd rawt ray. rayb rayf rayh rayp rayo rayy ray& raya rtyrty. rtyw rtya riyó riyi riya riyaw riyay ri/uw ruwd ruwf ruwh ruwt ruww ruw? r?C r?ow r?r r?s r?w r?a r?a S-f s.a sa. sa. saa saf sao sat saz sbl sbr sba Síl str s¿oy sdow sdaw S£. S£f S£p S£ó s£e sfl sfr sfa sfty sg£ sguw shw she shay su sig sja sj£ sk. skf sla Sl£ slu sla smi smw smaw sn£ snm sne sna snuw sowa SOWE sowg sowr spr srt sre srty sruw ssa SS£ ssm ssiy stf stg stk stp stt stu stj s te stó staw suz sva sva sv£y swu sway swEy sjuw syiy szow sa£ sak saw sa? see s&£y s&iy sea seC sat sei saj se? saf sam sao saiy saym sayn sayp saya sfyd s£yh s£yk s£yl s£yr s£ys s£yv s£yy s£ya sfyaw siyk siyt siya siya siyaw suwn suwp s?£ S?l s?w s?a s?a t.a t.E t.ow t-P t.u t-tv ta. tat tbr tba tbay tía tôt tie tíiy tda td£ tda tda tday tdEy t£? tf £ tfi tfl tfy tf£y tg£ tgi tga tge tgay tgEy thaw thay thuw tlt tig tip tir tiv tiw ti6 tji tki tlb tie tía tie tluw tmd tm£ tmi tma tme tna tns tnz tne tnaw tn£y tniy tnay towd towm towr tows towt towz tpe tpa tpay tp£y tpiy tsj tse tt. ttay tub tuh twi twu twa twEy t/ow t/e t/Ey ue tad tav taw t&ow t&Ey tei tej tej tez tea tea tad tai tal tao tawl tayf tayj tayk tayl tayp tayr tays tayz teyf t£yt ttyy t£yz t£y& tEyaw tiyg tiyh tiyl tiyr tiyt tiyfi tiye tuwt tuw£ tuwj tuwl tuwr tuwaw t?i t?n t?a tay. tayl tayn tayz U.S ubay udl udr udu udz udO ufm uh. uhaw ukb ukd uka uka ukiy ul. Ull ulv ulz ul& umd umn umt umEy un. unow unt upi upl ups upw ur. urk urz usd usg uss UtE utf Utl utm uta utiy Ujl ujm ujt u/6 uzt ued u?b 0-9 0-1 0-m 0-n 0-r 0-t o-y IJ.O G-ay 0-i Y qal Qar Oba Oba Qbay QCn Dtp Qfe og qga Ogr 003 ogay Qim qiw qkb Okg Okm QkJ Qky Qk£y Oliy qmay Ont qnow 00- Ora Oray QSk rjsn QS3 Ose qsa Qtay Qt£y qw£ oye 0« Ozaw Ofli O&i O&a 06iy Oe. oef 0»9 gek oet Oez Q8Ô Oad 0«f Oam oan Oat •jayd oayl oaym oayt Oiyh QiyJ Q?i r.a r-I ray raí rar rbi rbow rbaw rbuw rC. rCf rift U?E U?l TABLES OF 1 1 1 1 1 TRIPHONES 1 1 1 1 1 (corn-) (cont.) (cont.) (coru) (cont.) (conL) (conL) (conL) (conL) (conL) u?n u?s u?6 vyiy wna wnt wnt wn& wown wowz ws. wuf wup wua Jowz Jst ysi yst yt£ ytu yun yuj yuz ywa yon yab y a£ ya£ yaf yai yav yayn yuwa yuwf yuwj yuwy z.a z.C z.z z-i z.e zaf zal zbr zbaw zCE zSi z£e zda zd£ zdi zda zday zduw zjow zja zka zki zkow zku zl£ zla zliy zluw zm£ zmow zmp zma zmuw zn. znp znt znj znz znaw znay zow. zpa zpp zpa zrf zrow zraw zsl zsm zsp zsw zsa zsaw zsuw zta zziy olh oik 01/ olaw om. omp omt oz? oOe oa. oeb oek oem oet oayk o?r Oan Oawt Oaym Otye Otya Ouw. 0uw6 0?i Z£. ztow ztr zts ztEy ztiy VO? vOe v6E v&ow v.k v6o V.I v.n v6a v.s v6iy v.e ve. v.a vaf vav val vam vaz vbay va? vdow vaf vak vd6 vdaw v a n vtv vap vaew vfi vawt vfl vfr vay. vaym vfiy vgow vayt vayw vge vhow vEys viyf vhe Vll viyi viym vke viyw vka vkay viyb viy? vkcy v?r via v?o vlay w.r vliy w-6 vma wat vme w£. vma vnow web wed vna vpr w££ vrow wch vro w£q WES vre vsk w£6 vsov* w£ay W£? vst W.l wwa JOV W3d J6i z»£y Jek /aow wof W DJ wftow wa. wafi wa£ wef wak wak waa waww wayow wayr wayw wayb wayiy w£yb w£yh w£ys w£y8 wiyC wiyi wiyft wuwd J-a J-i M J-z I-o J-? /£l Jhuw /id vsiy vtc vta vwu vwuw vyi W1W Jig Jim Jiw Jke Jmiy Jnz wmiy /u- WW. Wlf WIDOW /tJtm /to Jur Jwiy Jyuw Jar VSO wia wt? wlv /»• /•» /•a /ad J*fl Jar /ayh /«y. /£yk /iy. Jiyi Jiyow Jiyr /iyy Jiye Juwd y.n ya. yat y ££ yti y£n y£v y£w yiow yiQ yir yi? y"a ymow ymiy yowl yown yowO yrg ys. ys£ z£k z£m z£v zfi zfa zfuw zflr zgu zhm zhu zho Zlf ztl Zt£ ZVl zwu ZW3 zway zw£y zjiy zya zyr zz£ ZDV zsa zii z&r z6iy zaC zai zal zay zaek zaa zaw. zawn zay. zayti zayp zayt zayw zayO zaya z£yd ztyr ziyi ziyl ztyr ziyt ziyw ziy? z?h 3.1 3d£y otv of£ ofs oft ofw OfJ ofy ofo of£y og£ ogg ogt oga oin 01? okd Dkh okl okow oka omw omz oma ona onb ont ond onf onw onz oowb opt OQb oqg OOP org arh orl orr ora 3?W own owo o?e its 2lay *yr tyuw to. tar ies tuwe O.b e.k e.t e.a e.? 8a r Oat ebl Qbay Ode OEn 6fu Ogow 9hi 9im Okr Ska Oma Sows Opa 6r£ 8sow Osp Osa Osa Otuw 0W& OWE OS. ost osb osa OS? ote otd otk ott oty ov. ovf ovn DVW ova jwm owe o/a ozb OZl ozb oziy OWOW Oyuw Oad Oek Oes Bez 1 (conL) &?a e.iy e.uw ean ebd ebp eC. Bt\ 6-E e£m efit 6.a Aba eCa edt &ba edn &E6Eb edu 6t. edv ftid edw 6i? ad? bmay e£k 6ow. eEl 6owi e£n Sown a£v eta &OWS &owe af£ &row efk efow &od &OZ afiy 66iy ag6 egEy 6el 6eow egiy &ev eguw 6a6 ehh ehm bee &eay ehs ehw &e£y 6eiy etl 6a. eit 6am eiz &av ei? 6aew eja 6ae ej£ 6awd ekb ekd 6£y£ ekj 6£yf eky 6£yt ekz 6£y] 6£yow ekuw 6£ya aie 6tym elm elO &tys env &tyw &iyaw eown eowp 6iy? 1 (conL) apb app ep? epoy erjs eqt era ert asa esO es& es? ate etd etg etl etow etz ate etaw evk evz evaw eviy eww ewaw ew? eju ejuw ey. eyh eyt eym eys eyt eya eyiy azO eol eOm eOp e6t aOa aOiy e6b e&m ee. eek aap ees eet eew 572 THIRD 1 1 1 1 1 GRADE 1 l 1 1 1 (cOflL) (COOL) (com.) (COOL) ( cont) ( cont) (cont.) (cont) (cont) (cont.) (cont.) •M aah aav amm aawt eayd •ayr atyr aiyC aiyd •lyp •lyr •?d •7f aik alow •W ala aliy am. amf ami amt ana apb •Pt apd «Pf apy apiy aq. aqi aq8 age aert arj aal asm asy aaiy atf atg atp atr att atay atty atiy avg avh avk avn avy avz ava aw. awi aws »Ja/. a/h a/i aja az. azt azy azz az& all atuw mO. a8b a6c aba aa. aaf aap aaz aa? aaf aan aayg aayr aiys atyz a?k a?l a?p a?/ a?z a?a a?? aw.f aw.g aw.h aw.n aw.a aw.ay awC. awi. awfib awd. awdow awda awday awduw awcn awgow awgay awhuw awku awl. awla awm. awmr awmay awmiy awna awnc awnf awni awnm awnr awnz awne awna awowd awowl awrow awsb awsd awsk awaow awst awaa awti awtn awtw awtD awte awwa awwc awji awfe aw/iy awyuw aw6. awec awOf awOa away. awayg awayv awaya awayiy awiyd awiyg awiyh aw?g aw?] aw?a aw?w awTy ay.b ay.C ay.n ay.p ay.r ayba aybg aybl ayba ay6c ayCty aydd aydg aydl aydm aydy ayft ayfw ayfo ayfaw ayfty aygl aygft aygty ayhow ayhaw ayhiy ayhuw ayit ayi? ayjiy aykb aykj aykk aykp aykj aykO ayk? ayld ayly ayla ayley ayme aymr aymj aymuw aym? aynb aynj aynm aynp aynw ayna ayn6 aynb ayna ayniy aynuw ayn? aypEy aypuw •yog ayrc ayrow ayra ayra ayab aysh aysw ayaay aytb aytt aytf aytg aytl aytm aytn ayty ayta ayuz ayvd ayvf ayvl ayvp ayvr ayva ayvO ayva ayvay aywow aywcy ayja ay/u ayjuw ayyc ayyow ayyu ayya ayz. ayzm ayzt ayzaw ayzay ayal ayan ayar ayOa ayOaw ayba aybiy aya. ayai ayaf aya? ayaz ayawiy ayayn ayays ayaye ayaya ayty? ayiy. ayiyg ayiy? ayuwk ay?b ay?C ay?d ay?h ay?i ay?s ay?a ay?iy ey.d Ey.E Ey.g Ey.a £ya. £yam £yan £ybr £ybu Eyba £ydb £ydf fydr £ydy £yd? £y£n Eyfr EyEv Eyfa Eyfa Eyfaw Eyga Eygd Eygh Eygi Eygl Eygz Eygo Eyge Eygty Eyha Eyhi Eyhaw Eyim Eyit EyiO Ey]ow Eyja Eyka Eykl Eykr tyky Eyka cyka Eyld EylE Eylow Eyls Eyla £yma £ymh Eyms Eyma Eym6 Eynd £yni Eynm £ynp Eynt Eynw Eyny Eyni Eynay £yn? Eyowp £yp. Eypa Eygh £yrb Eyrd Eyri Eyrj Eyrk Eyrl Eyrn Eyrs Eyrw Eyry Eyrs EyrO Eyray Eyal Eysn Eysr Eysaw Eysay Eys£y Eytd Eyth Eytn Eytow Eytw Eyta Eytb Eyt? Eyv. Eyvm Eyvs Ey/n Ey/ow Eyya Eyyi Eyys Eyyu Eyya Eyya Eyzg Eyzh Eyzn Eyzw EyzJ £yz6 Eyzaw Eyziy Eyaw £yiy EyOow £ybi £y6a £ya. Eyad Eyaf Eyat £yav Eyaw Eyaz Eya? Eyad Eyaf Eyat EyawC Eyawt Eyayh Eyayv Eyayw Eyiyf £y?d £y?ow Ey?p Ey?y £y?a ty.d iy.£ tyak lyal tybow tybu tyba tybEy lybiy tybay lyCg lyti lyfin iyCp lyCs iy£x lyCEy tydf lydg lydm lydt lydu lydy lyda lyday iy£d iy£s tyfa tyfu tyfy lyfiy tyfuw lyga lyhE tyhl tyhy iyh£y tyhiy lyif iy|a iyjiy lykm tykow lyks lykw lykay iyl. tylm »ylw lyla iy!6 •?y mai abl sbm mti act ada ad£ adg asdh •dl adn adp adv adj ady ada afa afd afk afa afaw agz agiy ah. a h ay aii) ais ai? aka akd ake akp ake aka akay all 1 (cont.) iyyt iyyi iyz£ iyzk tyzow tyzaw lyzey lyity tyluw lyziy lym. lyal lymk lyor l y m o w lyab lymz lyta l y m i y iyea lynf iyek lyng tyOaw lynp iyblyns iy6ow lynw iy6r iyn6 tyba lynaw lyftEy lynuw lye. lyows lyaC lyeh type iyp£ iyaj lypm tyaw iyp6 lyaa iypay l y a l lyra lyat lyrow lya? tyru lyawd lyra lyawt iyr& tyaw? lysi lyayh lyss tyayk tysw lyaye iys6 iyayaw tysa iyEyb tysaw iyEyt lyta tyiyi lyv. lyiyd lyva lyiya lyvg lyiyt lyvi tyiy? tyvr lyuw. lyvt lyuwa lyva tyuwe t y w a iy?b iy?i iyjlyja iy?k ly/u iy?l iy?m iy/Ey lyya iy?n T A B L E S OF TRIPHONES l i l (conL) i l (cont.) (conL) (cont.) iy?p iy?s iy?u iy?y iy?D iy7e iy?ae ty?aw iy?£y uw.a uw.t uw.r uwaC uwam uwba uwbc uwbl uwbo uwbc uwbcy uwbiy uwboy uwC. uwCt uwd. uwda uwdow uwdr uwds uwdy uwda uwday uwdiy uwf. uwgi uwgu uwga uwgEy uwh. uwh£ uwhi uwhow uwhaw uwhiy uwhuw u w k c uwOaw ?ik uwkiy uwd£y ?iq uwlf uwa. fif uwag ?ie uwlg uwlk uwej ?kd uwll uwak ?kl uwaeti ?ko uwlr uwxn ? k c uwlt uwaet ?la uwla uwmb uwaw. ?lt uwmm uwawa ?li uwmr uway. ?liy uwma uways ?luw uwmawuw£yt ?ml uwna uwiyc ? m p uwnd uwiyz ?mt uwnc uwiy? ? m í y uwny uwuw. ?n. uwna uw?. ?na uwnoy uw?. ?nd ?ng uwpl ?.e ?nh uwpr ?.r uwpEy ?ae ?ni uwpuw ?aa ?nr uwri ?nt ?aay ?nw uwrow ?a? uwrp ?ba ?n6 uwrfl ?be ?naw uwny ?bo ?n£y ?baw ? o w d uws. ?owk uwsm ?Ca ?ows uwsn ? C a uwss ?Suw ? o w w ?owiy UWtl ?d. ?pd uwtow ?d£ ?dm ?pm uwtr uwta ?do ?pow uwv6 ?day ?pr uwway ?diy ?P» uwj. ?£. ?paw ?r£ uw/a ?£b uw/ty ?Ed ?ri uwjiy ?£fl ?sb uwyiy ?tl ?sn uwz. Wi ?s& uwzl 7f» ?»» uwzm ?fty ?saw uwziy ?fiy ?td uwad ?fll ?tf uwok ?go ?tg uwO. ?g£y ?th uwOa ?ho Tto UW1Q uwis uwiz uwiB uwjn uwja uwku í (conL) (cont) ?te ?tty ?t? ?uh ?v£ ?wa ?wo ?w£y ?/ow ?/iy Tya ?yiy ?zw ?am ?ov 70i ?aQ ?av ?az ?s6 ?aa ?aiy ?a*h ?mk 7M ?w] ?az ?asay ?aw. ?awd ?ayb ?ayj ?ayk ?ayow ?ay; ?ayO ?ayae ?ayiy ?ayuw ?£yg ?£yk ?£y0 ?.y. ?iyd ?uw. ?uwi ??a ?ay. oy.E oy.h oy.m oy.w ay.6 oy.a ay.ay oyfr oyga ayin oyla oyn. oynft oyníy oynuw ovog ays. aysk Dysíy aywa ayz. oyza ayzw oyzo oyz6 oyzft syziy ayOr 573 8.9.3 Fifth Crade Tables of Triphones Fifth Grade 517 .aen 385 am. 371 .an 355 ..w 353 wan 323 t.. 301 6er 296 waz 291 -V 289 .we 251 -hiy 250 layk 248 n.. 247 232 ar. 227 z.. e6e 226 .ya 225 anow 221 yan -J»y 181 S179 6£n 178 ow.. 176 -yf 174 213 .am ter 209 ver ..a 206 ..a 201 .w£ 200 war 197 171 168 sem an. 164 dar 162 6is 161 -wiy ste .6a 195 6Er wtn 191 6iq •y 186 240 now. r.. 184 160 159 m.. 158 n6e 156 hav 155 .6 153 ana 150 ..h 6a? 129 had n&c 128 .6£y and 125 ..n 123 .may ..s Emy en6 147 122 149 ar. 143 ars 141 .yuw iy.. 140 tywa 138 dfar 137 .be 135 -?e 133 den 131 ide did 121 ant ard 120 1erz 117 pity an. 115 ans 114 .now now. abaw 111 (conL) (COOL) W£l «n. yer ark 95 110 94 ..? Tts 108 93 ist 10- 107 92 del 6at 106 91 Jes tsa est 104 89 nda tvr 103 87 -6£ ere ?am 86 102 zen ken 85 101 end ..d ez. 100 taym 97 k.. 112 96 ?we an6 kem enw erl eze 81 080 ine mis eniy 79 ..ow nwiy 78 Cer sta enn uw.. 77 ..m in& ten yea 84 76 owve vny ern lyha baw? gat men 83 nhiy ran zin ade down 98 82 (cont.) a? £n. n.e 111 95 82 .sow .6* £ve 578 75 74 art 73 riyl 72 ven 71 iq. njiy 6et 70 bet dawn nd. ada ame enay iyCe 69 bed l?W kaz a.. eve 68 ..b n&£y ner sen z.e 67 -i sow. erw £y.. 66 her n£v 65 £1. one em. iys£ 64 big for it. n£ym tar tiyi erg ayk6 tydi 63 m.w rwe &e. 62 an .se rem rayd egf el. er6 61 dem dez me6 eke erh aywa 60 we? yuwn •h» 59 54 i/t nwe wet wiyw egow ayhc hiyw lid n.6 eh. ayke 58 .ayd irjk Ony iy6i 57 53 be? bak din las ediy ewe 52 .de maym .tuw .eh tag erf a&e aylay gowi uwnow iQe is. 56 kin its nte 1er skuw nsow sez owld wiyh tad y£e wiyk bes &ew aba eri 51 erm ese ade nmay 55 nne ard nyd fte eve lyst g«? hiyi 50 nye ser -aym ark &eb aydow ow.& £nt g" T A B L E S OF T R I P H O N E S SO (coot) 46 (com.) 43 (eont) 39 (eont) 37 (eont) 34 (eont) 32 (eont) 30 (eont) scd t.a •1. aft lyda haf int nsa nts par tarn bak apa ats a7t rse raft uda ftcyw ans Eywe tin wud zar 316 •Pas. anay at ayk. Oar ala amy aymz Eyha giv may. mayn nz. ne6 str toh vam wiy. 16a lam mar Stl sta ta. ala ayga ayOi lyba na. nap ow.h par no sow6 tuwa vin wiyr adi aduw alay awn. 49 IM kta m .6 rawn wiO •mi aru lyga 48 .ha .lay ini kan kuwl mayf miyn n.w nyuw ttyk erb •t. ayme 47 dab End fra gar in. IQZ pal rda òam amp emz anh am any ewEy 46 .61 art faò 45 .ka bar bawt d.a M . s.a yuwk bag abiy azi ana aydi AA 44 a.. bra dav hiz hiyd ita kaz nit rcn rba scz SIS ts. a?. lywE 43 .ayl dig Ede Erz f.. fl£? hiyr min n.a 42 ar? bol fayv kal mayd ow.w ran ali 41 .ow. Est tc) twa tas 40 iza kiQ n£n OWIQ pan rze tray wad ftan araw ats lypa 39 .ar ta. Er. hiy. ksa kal kfta nas nat rst sik swe ?.. 38 .di .a. bal das Enay Er. gowz gud htys kar m.a nam ts. wai yuws 6ap ont an m an/ api ayda ly.a lyz. 37 .En .ayh .ayw .?ay ..k dad Eks En6 gan haz it. kit rz. tap Jiyz 36 .ta ..E dfy. Eni Enw gan ika in. nat ni? noww ownl Jiyw on6 er>6 ayuw ?ta 35 .fa Era IZ. kar uy- ntuw niyO ow.a Pr.a rta tab te6 zwa art ada ang at. ayda aymiy ?e. 34 .wi dit day Jiy- Z.6 ard 6£yh aTw awda lyka ?an 33 ¿EV .gow di? dad gad Ian mar mwa mOi nin nnt nnow sin stiy sab tuk tuw. wal wiyd 6od 6£yd em® any ant ly.w lyzg 32 at Ena En? hEd liQ 31 -ab -ayg .aye -?E -t its iks iva i?. I.a n.h nowft nan owwa r.a sap t.a Jan 6af atE ata aynd uwst 30 .bi .mi .al ..f ala buk biyk dEn Ens Eriy Ez. frE kud muwv nowa 29 .ha dap d£y. Ea. Ed. g ra grEy hiyg kayn lEys ndi nad nayt own? owst r.w rayt tap tiyn v6a wiyg Jiyd /iys yuwz zta 6ah alz an? arow ati a?w aykt ty.a lyve ?6a 28 .St d6a Eta g£d haws luk n.? nha ow6a rdiy rga sal tin v.. odEy amt arp asi awiy awta aw?. ayki aynow ayna 27 -hi .IZ -Je at. ata d.6 ins iq& ks. kap Ida Iz. lag nst niyw rtiy St. stEy tik awiy &iyz am6 amay ank anp atr anh 577 27 (eont) 25 (eont) 24 (eont.) piyp rEs rum riya siz t.h tak taf 26 yiyr yuwg .biy .haw z.w .if &a? nyriyb ftEyr .?a bik sda al£ da. soway ani k.a spE aray atw kst tfta kad wiyz av& m.h aya *-y mil azb zya m ayk 6owz a d ly.h nliy 6Ey. ntay agay tyka arE lyliy naf rin amp 23 anw riyt ruwm ata -riy swi .ayn aza wEr ayan aks Eybiy ana Jiyg lyan z.h ats zlay ?.a d.a ale dal 24 dta aliy dak ary .sty btyb atiy Ell ann dyuw idi inf igt Eyda uwka inn kid ?in lin IQl ?an liv 1er mows m.ay 25 mayb mba .na miy. mays n.y .SE n.ay .an n£k na? -8r mi] nal njo pud -0 nlay Q.a Eia Eny nah r-y nayw rma Ea. fyuw n?. rye ara ast awnd Eyka lygow lyza ?En ind m.y mEyk nt. niys par r.h rdrks rz. rak FIFTH GRADE 578 23 (com.) riyO sar tek tuw. zfta adr eki 9kl emiy ask ay.. ayfa aysi iy.s iyrz 21 -ay. a?t 20 20 (cont.) (cont.) .el .ayk dye ..a diy. dre £nn dz. £nj duwi gow. ilk i8m iss IVZ ki? k£ym lis l£yn l.w lab m.s m.J m.ae maen mz. miy. nd£y nar nan 22 niz neb .fay nt. niyz .ko nz. ow.b nSi rdi ..1 nak rfe fen nayd rke ow.ay rlz g ks. r.6 rn£y k6i rd£y rts kaet rcyd reb laen riy. s.w ngow sayd r?e sen nnay twe neg ye. t.? owin z.ae HQ pin a.w tat riym e.y Wl6 9.6 s.6 yuw. sev eday yuwl St. alb yuwr sta z.? etay triy evi zga /iyh az. ode y£s azs &el zeb aekt ekr 3l. sv. epow ore aw?t er? aym. e?e anb as. lyr. aeny ask uw&e aen? ?tuw ae?. a?b awt. ayks 20 ayyuw Eydi lyk. .fr lybr ?.w lyn. .ray lytay t.. 19 (cont.) 18 (cont.) izn Jam k.ae .duw kra k&e -ga at. Zl? Id. diz zny Id. zon deg Iz. zem m.? deh £n. zes miz £nh ols mayl Erw e.k nev ebi niy. fif howl ed. ow.y p£n kiyp efr rjka lev age m.b aid gte amb rd. m.i miQ asp r£d azm mz. rk. ryuw ezt mbe m£yd 8Z& riys n.b st£ aed6 aeni n.m sye n.; awn& s£y. ayt. nd. t-v nmi type tel nowh iy.5 ud. n&ae lyse uka niy. lyz. wim w£y. ow.ae 18 owda Viowen .fi an. piyp -pl ôiye ra .sk e.f rhae .ays a.t rk. dan ebl sit diy. afi s&e gowd afa siy. gowt aka t.w g£yv ala hm. t-6 anf howm ana thiy hiyh anas tsr htyl en£y tst tor id. epi tew ift esc taen ify ess tuw& im. ezg wiys is. ezh wiyae isi ezn Jar iz. aykm ly&a 19 AO yak yes yuw. yuwd 18 17 (cont.) (cont.) aykae Eyks iyje lyr. uwzt ?6ae al. ars 0.. eh m ehow ekae emh 11 7/ emm .IE epiy .way err bri ere d.w et& dag ewa a?t det £dt awt. £diy ayst cpt ayt. £?t Ey.e Eym. ftiy g£n iyg£ gowe lypl gayz uwl. hiyb ?-6 i£a 16 ika im. .pu inm .si .t£ iQg isb .tw .ar i?e kriy .ep .ayv liVm.t -P bed mpe d.h mat mayg d.y dhae n.i ndaw dz. ns£ dayd dEyz ntiy ownn diys owwiy fba imi r.s tt]b rit rek mi rtyt IQ3 isg sse stuw l?S thae lad tev lak vEn let lis ves 16 16 (cont.) (cont.) leyd m.m mal mes n.s n.t ndr nsi nay. nays niyg P£l plae pra rbr rdz riO rel rer sEp soww sow/ uk. uks v£r vga wad wan waw wayd IV-/ iygEy uwlay uwwe ?wiy /•- Jiyt yar yad yuwh aki aid ar. az. &£ys e.h a-? agr am£ ana anC ap. eziy aen/ ayfa ayvg aywE 15 (cont.) G&e rab ran rgow rhE ns 15 rt. .huw rtuw s.s -/i s.ae -/e ski -ayy sad atA beb til towl baed bawd tyuw biy. tal tan dew win Eke faem wak /er fiyt har yuwt hwE z-/ h aen zgow zga haep ige ze. inw ann isk arn tti 9ruw i9e fttyg klae abr kmi agi kar elk keb amw ket amae Isow amuw ep6 Iwe lEyi era m.f era m£m erae m£n erEy mliy esiy mtay eta ndiy ezr ezw nis nnEy ezy nwi aedi new aek. naym aeml nayn aepe niyd ae?. niyv aygE pn ayje 15 (cont) Ey.6 cyki Eysa lyin uw.a ?hae ?yuw 14 .ar .li -tty .?ow -I ..3 ape ble ben day dag deft Emb £8. fut him har hen idz ik. iliy kaf Idi led liys mi6 mid map n£e nEr nowv nsiy nze n8i nOe niyt n?t owte owz. p.a Pik pows T A B L E S OF 14 14 13 13 12 12 12 11 11 (cont.) (con t.) (coni.) (cont-) (cont.) (conL) (coni.) (cont.) (cont) PS. par ijer r.b r.ay r.? riz rni rowd rsk ral ros ròt res ret rem riyz slay sma spi san tes tsk tsow tòa tam vye vet wan wey. /•I z.b za z.s z.t zbi zdey zge zna zel zep or. 6in Ò1Q e.d e.s ebe eëe eka en] ept eth azo adt cnm «t. ayse ayts eyje tyve lyrg uwha ?-v ?se ?t. mmay mei mar miye ndz ni/ naw. nayg ow./ owhiy owniy owjiy owòa p.e pte pul put r.m rki rmi rowp rzow ray? riyk sek sow m sst stw t.b t-ay tsw tòe tuwb ud. epr epa epey er/ etey ewa eOi an. aw.. aygow ay m. ayOa cydow cymi eyt. ly.t ly.y lyfay enj es. ese et. e/e fin gowa got gcym id. idiy iki ime inb inh irjs isd i/i i/e rak rde rhe rj» rkw rliy rmay rtr red rep riyw s.b s.t si? ske se. saye tu ter tri tre trey tsi tsô tway tbiy tiyv ve. wiyp /iyk yeg z/iy zòi zeg esay evy eway aks arty ave avi aevò a?n awne aws. aw?ò ay-ay aybr ayd. aygr ayn. ayòe ayer lyd. tydr lydey lyfe tymay uwde uwsiy uwviy ?.s ?.ay ?we ?òe ?ed OIQ -br .hw .nay -Be .af abl ant arm arv bes bin bla bruw biy. fien Ceyn dbiy dhiy dre diyw enz e?. hat idy ifft ik. ina ina iniy iQh isw i/izf izm i6e i?i kep kti l.a lat Ibiy Iney liyg liyp liyw liyz m.d m.g mzi mze mar mayt nday ngi nke npu ne? nan ow.m ow.? owzl owem ower prow pep QZ. rjan Den rge rid ril rli rse rt. rev riyf nyg riyp s.h sel ska Sil sowe sowiy sny stay sew siyi siyò t.m tit tsa tiy. tuwm war weyd yel yeh yew yuwm Z.I z.m zje zed zet alow ani e.m e.p e.a eba ede ein eley emow enr enuw erj esm ewi e/iy ezp 1 1 -fa -9' .1« .me -OW. .wa .Si .ayl ani a?. bliy boyz dij dis dmay dray dwe es. et. fray gowl gai idn i]e ink inz isl klow kle kri ksp kwe lek Ize Icye m.l mam VII) vit wes yuwi Zlt zowl zown zowv af. ont ariy Ome Grow òiye e.ay ef. efay emk lyli lyn. lyriy lysi lywa lyye lyer iyeò ?miy ?ep 11 1Z .dow .dy .ka .ma .naw .pr -tiy .ek .et .aye akt bad ber bek biyC Cik d.s dan dim diyd duw. eis IZl kei kwe kye kyuw kan kat l-ay lay? m.p mps mam n.e n.n nfr nfay ngc nid nif nni nniy nal nayh niye n?g ow.i ownt owan pio pra pòe rjki r-J alw ate Ò0W. »8/ e.n ebey eda efy eha ehe ehe eks elw epe eruw esd esw 579 TRIPHONES 11 11 (cont.) ezz eòi eem ak. ame aeri a?m awn. aws. awtft ayfr aymg ayz. eyiQ eymd eynj eys. eys. cyts eyen ly.d lyiz lykey lynay lyt. lyt. lyte lywiy iyör lyem lyez lyad lyan lyaev uwle uwyuw uwer ?.m ?it ?al 10 -gay .mow -pa .sp .sey .wey .es .?a .?n ag. 10 10 (cont.) (cont.) ar. brow bayk bayft bay. ¿el d.i d.t d.ay ded d&i def diyk duwy duwft duwe elz £16 erf evi eòe e?s fye fes ges g raw gay. h.. hil hawd hiyj ifi ine iny iQf i/. «O izh i?n k.w ken kse k/o la l.ò Ibe lowv lye lyuw led liyn m.o mmi mpi n.d n-g nad nfa nna nsw nte nwe niyk niyl niyp ow.s owdi own. owze owòey owet pu? pan pawn Qeb rowk rsiy rzd rzi re. reyn r?t sal se? sfe sgow ska skr ssow seg t.s t.t tam tra tsd tsy tsey tey tiym vri vel vep we/ Wll 580 F I F T H G R A D E 10 10 9 9 9 9 8 8 8 8 8 7 (cant) (conL) (corn.) (coot) (corn.) (conL) (conL) (conL) (cont) (cont.) (conL) (conL) ways •yiiymfy dba me tgow av. -tr isp owna wcya Cyk. ami dif nowb tid ajow -ts tzk owzt wiym cym. arz lyna dlay npl tiv a/a .wu izow ow6£ wiyt cymw ara Jiyp /iya yel iyn£y dra ns. tiz azay powz bak dza ntr tmay a&ow Jab psi /£l /is Cyn. lypu -/a .af izs yam cyt. bowt yuww iyol dal tsg aan -ag k.h pan zhiy tsl a?k .eft k.6 piys znow z.ay dftc »y?u w g o w diyn £y/e ly.b bay. yuwa ne. nflr nftiy tsn a?m an. k£r Q.a zniy ly.g bay. zba UW1Q dtya net t&l afd ar. kil rduw zwiy ly.i Ciq dda bayt zhe uwku duw. na? t&ty afa arb kim rfr zza zmay uwl. £.. ncyt anc arh kliy nf zal iy-I lycr zncy uwm. cdl niyf tiyty tuww ang b- rip zaw lyku dtv ztuw uwan owba udi btl i-y Ibi nv af6 dig z&Cy ?.h fly Enm owhav uki •?y awnt bam ICS rn. air «yig lyma zak ?.i En ownm vyuw ayd. tab Ika rpa ans typo dcr dik aks ?.? crs owpa vftiy ayka d.f Imiy rpa asa lyri dj» dsow arm ?£V fowr OWM vad aymay d.m Ita rsi azw lysiy da? fcfyl ?gow fny owy£ ayvm d./ lor (VI 8o? lyvi daw? 6£yt ?IZ fol OWZl Jiyl Jiyn cy.y dowv l&i rawt 6CyJ lywu diyl a.g ?i? f&cy ps. z.k cyba dra lak raya &cyk lya. duw£ aba ?ka fam zda £ydiy dst liyb r?s 6cyp lyaf Cd. aboy ?may fiyl Ptpad zha cyst dar liye S-f &£ya uwen eft ads ?6i gz- pern zmiy daf m.J s.m a.i aha ?ab igikt pal Q-b zruw cyti Cyar dan mba s.r abay £k/ eld zsow lygi dayv mdaw sga at. uwga uwn. uw2a elf ina rjlay zsa lyha diyz m£r sgay akc ?.t dp ?fl£ £lt ahaw Q •Is alow -diy iQm lyka £dz mpl sma akw -ga IIJW QZ. rap zyuw als z6c lymi Civ mav sncy ekiy alt -ki ism rba all lytu £liy mayh sowh amd -kl iwa rba aim lytEy £t6 maya ems -ku izb rfa alz lywCy f.a ama .tow izp rna 3Q. lyzr •maw .aw 181 rna aa aru -a? 1?. ?lay £ma epu ?riy Cne sray ascy ?st crb n.O swiy az? ?ya try fawn nda saf ad. ?8i Ctl UWlt fayn ndm sas aenf ?&cy Cviy orfl uwat fayr nfa sad asa ?as far a/a -ayf kowl rpl rny av6 ?bi gow. nha t.n avt azj ..r kra rsow Oam ?baw h.m nim tak awaz azl a£a ksw rz6 bat ?kay h£l nma tis aw?w .da fla ®zf apt kwi rOr a.b ?tE h£r nown tlay ay.a .fa f&a a?s arp ka/ rayv a-/ ?Wl hayk nowz tsb ay. a .mcy gid aka a?a ka? s.ay abl hayn noway tsp aybc .miy a?b bowO I.m s.? abu o o hiyk npa tsay aydcy -S3 gi? gla aw?« bra lef sbi edb -al hiyt nsk twi aykw -ta ham ay.m bar lev adow -baw hiya ntw tya a yH -WO ha? aylz beys af. .da if. nt& ta/ aynz -a? hawm ayma biyf lip liz SIQ ska sliy alh .£k ifa naz tcyt aypl .awt hcyr ayv. biys Iwi smay ama ild naw. um. aysa .ayow hiyi Cymz biya las SOW. anaw -U .ka in£ nayf um. ayta -ayr hiym Eyma Caz Ityg stu apa .ma ing niyb v.6 ayv. .0 eyz. d.b m.k saft apa .nc in? niyh v.a ayvi adi 7 fda fd iQ ijuw lydow d.? mfa scym asf .na ips niyr vab ay?. aki ikl lycn dak mal siyn asg .owy iijd nuwn WIQ ay?t alt imp tyks dar nba t.d asa .piy IQQ owgr waya ty.w a lay inj TABLES OF TRIPHONES 7 (coot) 7 (COOL) 7 (COOL) mad rzw lOt mas roQ IQP mawt r6a 1ST miyd raw ith miys raz its n.f rayz lt& n.l IVl rcys nbiy nyC ila ndft i?b nyn nik ruw. Inkt Itk ruwp Jan nowp ruwa Juws npiy 8.1 k.r na. •-Y nva sbay k-Y nwa S£S kat n/i kcl sma niym sowb kla n?m sowd kit n?w aowk klay kmiy n?y spa owmay spuw kai ownow 88i kas kway OWt- •ts kaw owtuw sak kayn ow/i sa? owz. sat l.h ow?. sa? 1.8 siyr Lt pit 1.? siyz ptj suwz Igu pra t£V lit pas Iowa piyr tsc Iowa puwk tarn puwl tss 1st lak ttuw qgl twiy qin lap nop tjiy lat layn r.f taa r.k t£yd ley r.l liyf tuwd liyh rbc tuwy uk. liyr rbu mat rgi ukt mda rhaw urn« Vlt mtt rko mha rla vza mik rnuw vak myuw rowt viy. man rowa wEw mad rpiy wiC mak rzn wown 7 (com.) WD/ wiyl wiya Jow. Jaz Jiyr v« ya yaa yuwc yuwp z.f z.n zar zba zba zfa zid zli zma zn? zpa zat zah zawt afb 3fl sis and onm any art aji lal 2an 8an Oawz 6av bcym a.l a.6 adf adt ady acv afl alp ala amcy aph apa aqk 7 (coot) aal asn as? azk azow aza a?n •?V ads adw aki akl aliy apa aqk aan a?h a?a awnn awta awza ay.h ay .a ay-» ayhcy ayn. aynt ayown aypu ayad ay?6 £y.a £V? fyd. cydaw cygz Cyin cypl eysi cysk cyta «ytiy ly.f lyds lyfa tygu lyk. iyk£ tylb tyla lylay iymc 7 6 (conL) (COOL) lync agow lyni ak. lynow ana lyown anz lyry arf lyre arg lyray a?b lyso a?w lytr a?A lytuw bif lywa bla lyzb bli br£y lyzk lyzn bea lyzt Ctuw lytyt d.n uw.y dka uwm. dliy uwmay dap uwac dsa uwfta dacy ?.b dsiy ?.n dtuw dcyn ?-/ ?naw dcyw ?8l dtyay ?t. diyg ?wu diyp ?ah (daw ?ar £gz ?at Ekt cm. ay.. £np 0 erh £rl .ba .bay £rn £r6 .dc CSS -flu Juw fhi .kw fiO Ja fis .n& fi? .oway frey -tay ful .ve fal .?aw fcys .?£y fcyv gar a.b a.ay gin abiy git at. gowh adiy gowa 6 (COOL) gow6 gny gruw gwa gza gal gas gay. hav htyt hiya tkiy lib ila mow iqow iqaw isf ish isy izd izl Jap k.t kal kfa khiy kad ksow ktuw ku? kav kar ka? kawt kcyj la? Icn lc? If. Iim IU lowp Is. Isk Isa It. It£ Ian laym icyk Icyt 581 6 6 (conL) Icyz owma liyk ownh mgow owzd m]a ow6i mki owah mka owayg mlay P-w mna pre mowr pti mowv pwa mpr p&a msc pan mat 0-J mtuw Q-y mft£y qga mak OiO mal Ok. may? Qks miyt a»£ r.n n.k nba r.t nbay rck rfi ndf ndh rfiy nda rga nfi rhi nga rhiy nhaw rii n? nki nma rkr now? rkt npa rka rl. npr rmiy nny nsay rn. nth rowl rowz nta nej rru nayl rwa nayp rwu nayy r/iy naya rzg niya raf n?b rcyz n?d rcy? n?k raya n?n s.g owdaw s.n owka sbr owkcy sdt owlb s£m owlay sha (COOL) 6 6 (COOL) (COOL) Sid skaw skiy sma snay sniy spa spu spa swa sah sat sav U tbr tEm tfr tma tncy tray tsa tsh tud tav tOr teC ta? tak tayd tiyr tuwg tllWl tuwl tuwn tuws udb udg udn uds uka u?. v.k vda vis vsa vwa vol wes wiz wa£ waft wayt wcyv wcyz wiyf wiya Jud yet ycay yaow yap yao yuwb z.a Zfl zfay zhi zik ziz zka zka zmi zma zma zpr ztc ztr zaf z6a z6ty zay zaw? afh an. ana anf DQt at. at& ava bem &az 6aa bad biya adh afa agl akd akow ek£y alaw amg FIFTH 582 GRADE 5 5 6 6 5 5 5 5 5 5 5 (COOL) (corn.) (cont.) (cont) (cont) (cont.) (conL) (cont.) (cont.) (cont.) (cont.) amn Eyz. ly.m iv-ay iy£i tyfi lyhi iyiO lykiy lylE lyln lylr lym. lypr lyps tyrs lysay iyt£ lyzf lyzi tyzl lyziy lyow lybE lyel lyep uwcv uwg£ uwhe uwli uwme uwmiy uwne uwsk uwts uwwa uwyiy uwzd UWZl uwOt uwem ?.d ?bay ?daw ?liy ?mi ?n£ ?nt 7tw .bay .b£y -Ci -dr .dty dfi dfe dgt dgu die dit dn? dn dra dsk dur dy£ dOr dba dbiy de. deO dee da? d£yd d£ye £dr £ki £kiy gowf goww gz gze ged h.f h.e h.ay hab has hawb hawk haye ids ida ife ifay igb ifli igs igw ikn il. il. ili tly ims imay inp irjr IQY iqa itf itt ivd ivy izw izb i9. lel ten i?h i?k Un I«k lel lap k.i k.m k.J k.ay kda kde kiz krfy ksk ksi ksa ksa k6£ keh kam kEys kiy. I.b l.l l.n I-/ Ibr IbEy Idw Idz lha lik li? Ik. Iki Ikl InE Ire Iriy Iwiy las I6£ Iba lawd layb layg l£y. Iiyd liyt m.£ m.n m.ow m£s mhiy mp. mpk mpiy mwi mye mzr mzt mzw mzaw mad môi meg mayp mayr n.p n.r n.a na. nbl ne. nduw nst nfo ngr nhay nil nka nka nia nowi nowl nows npe nray nta nti ntt ntu nt£y n/e ny£ nzd nzow nor nav nar nayv nayfl nay? niyC niyb nuwt n?l n?s n?6 n?e ow.d ow.g ow.n ow.p owbi owfe owl m owmE owp. owrd owsl ow/e owye owbiy oway. pap p£r pfe pkl pie play pse ptuw pet pEyn piy. piyE piyz Q.S qbe Qfe rjhe Qhiy Oit Qi? qmiy rsp rsay rw£ rfow ry£ ran rat rae rôt re? rag rEyk riyy riyb ruwi ruwft ruwe r?i s.k s-/ sba S£t sfr sgr sje skay slE sle sm£ sowl spow spr spiy ssEy sth stn stt sOr s6a s eC san sawn sayn sayz s£yi sEye siy. siym siyw t-g t.k t.a tan tbi tba t£d «p tfa the ti? tka tra tra ttiy twu tw£y taf t®I teiy tawt tayn tuwp udk udy uld un utb u?b u?n v.t var vhe vi m vmi vmay vte vtuw /iym Jiya Jiya Jiy? ye£ yuwa yuwi yuwj yuw6 z.a erv asa eta 9V. evh 8WU ez6 «71 adb adh adm cm. «now anz ana aes. ath avs awe a?k awer aw?f ay.l ay.w ayda aydiy aytn aykE ayku aymi aymw aymey aym aynuw ays. ayti ayve aywa ay av ay?n Ey.ay tyd. £ydr Eyga £ynz cyne cyowv £ypr £y»b « J EysE Eytb -b£ .fl .fu -fiy .how .hay .le .muw -n/ -OWV .pa .ta .tu .ev .ez .at ,.£y -iy abe aii am. amz anf anb amy ap. apr atw 8?a a?k b£k b£l braw byuw bai ban bas baye biyi biyw biyz C£r iek d-0 d.k daj dbay d£S £1. £lm Elay £1? Emi Ena Enaw Ert Er? Esd Esl Ut Eze E?b fia flay fu? fev fas fayd fayf fayt faye fuwd g.a gai gan gowb QOWV qqe qwi QZk ijel r.r rar rtl rfa rfb rgE rha nm rld rlay rm£ rnow row. rowg rowv vz. val wad wat wa? wir wum we. wayn wEyf wiyb Ja? JCe AP Jur Jiyi JiVl Zji z-g z.ow z.p z.r zbay zfr zgE zgr zhow zhe zhaw zkr zle zlu zla zri zray •zta ZWE zwa ZZl zOr zef za? ziy. ziyk z?e ag. agz akt aliy 5 (conL) eb. ebow ebs eda egu ehay ehiy ekaw elf ell emf emj esow eva ew£ e/i eza ezd ezf e?i af. akb ati aele an£ asi asm ass aty av. avd avy »/• a?a a?b a?e awdc awnz awtf aw?n ay-f 3Q. ay.g ast ay-p azb ay.? 6at aybe aydh »•y 6eO aydz bas aydb beyf •yfty aykb biya biyow ayky T A B L E S OF T R I P H O N E S 5 (COM.) ayle aymn aymy ayrow ayny aysD aytiy ayvt ayem ayav ayaz ay«? £y.s £y-J Eydz Eyd6 Eygr cyn. Eynt Eynay iyny EywE eyze eyem ly.k iy.1 ly.a tybay lyd. lydh lydt lyduw iy£l iy£v lyhay tyhiy iyji lylu lylz lyls tynw iyn6 lypiy iyrb lyrow lyr® lysk tysow lyss lytow lyts lytw 5 (conL) 5 (COIIL) iyviy ?owv lyyiy ?sw lyyuw ?siy lyzd ?tty lyzh ?az lyzm ?awe tyzp ?ay. tyzw ?ayd tyza ayz. iyòc ayze iyed oyer tyas A 4 iy?a uw.w ag uw.b .am uw.c -bl UW-? .da uwar .daw uwbae .ha uwdi .. .he uwdow .Jow uwge .k£ UWl? .me uwn. .ney uwsi .own uwtr .owò uwv. -pa uwvd -rae uwve .rey uwya .sw uwze -ee uwab .aea uwal .awe uwe? .ayb ?.f .ay« .?b ?-P ?.m -?iy ?al a.w ?an afif ?br ad. ?ba •I® ?ba akft ?biy aka ?dcy alf ?fi als al? ?fa ?ge ama an. ?hi ?li ap. ?now apa ?nay ari arn ?ow. 583 4 (cont.) 4 4 4 4 4 4 4 4 (COKL) (conL) (conL) (conL) (cont.) (cont.) (cont) (cont) ars ary ar& ati atm a?i a?m bam bar ba& bli bay bav baym biyb biym biyn biyr biyt ed& £lh clow elw emp Erd e raw ESk ESP EsEy eta ew. ces eeay f-y fik fix fit frae rpae rsd raw rtE rti rtk rta rzr rza rad rOi r8e re. rae6 rae? raw? ray. rayt rayn rays rEyl nyty riy? ruwf r?m r?n sbe si£y sdow sdr sEr sfl sha sht Sll sk. ski slEy sna snt snow sp£y SSE SSC swe sya syuw sal sef sayk seyl siyh suwn t-J t.l tbc tda tdEy tfa tif tim tka tke tli tmi tne town trow traw truw tsf tsj tt£ tte tee tiyf tiys tuwh tuwt tuwiy tuw? uda ukò v.ay vbt vdt vii vme vmty wEyl wEyt wtyn wtyy Jat /owd Jed /es /ev J£yp y£h yur yeb yeas yuwf yuwy z.O zbr zdr zfa zgi zgu zts zpE zpl zpEy ztEy zwa zy£ irte ipip iqn ise itb itn ity itiy izt izj iza i?l i?m l?Z i?a i?6 i?aw lak t-0 Ian fòt òak ]uwd fay? i£k Jayn fiy? Ctw k.b giQ Cwe k.p gis ¿eh k.s Sii gowow kan Cat d.e gowaw kbe deb grow kfi dkey gyuw kik dmi kla gap dmiy gez klaw dnc gayw kmay dow? h.s ksm h.w ksfl dpi dtr hat kt. dwi hit kt. dzf ktl he. dzi hez ktr dof haw. kuk daw huw. kze dayl ibe kad kftiy daym ide dcys idt kas idft kap diye diyf iday kaO kawi dtym idey diyv tfr kawn diycy ifw kiy. kiyi ikb t-J eah tin kiyz eda ilz i.e Edy ima lar Iba Idm Id6 Ifi Ifr lif Ua Iky Ikey llay lliy Imow Imay Iniy Isp Isiy Ivz Iwe Iwey lav l&ow l&ey le. laf laef lawt lay. leyb leym liyò liye liyay man mbiy mei mge mhae mma mte mtiy m/iy mzb m&c meb miyf miyft nal nan nfu nfae njd nlu nmey nmiy nna nowm nowr nam nsae ntg ntk nty nwa nyiy nzi nzn nzw n0s ne. neO naed nawr nawt nayk neyj neyk neyw niyj niyy nuwi nuwk n?p ow.k ow.t owbe owd. owit p.t phty powv pra pny psa pta pu/ pad pav pa? pty. ptyc o-f Q.h Q.W 0-6 qde rjdaw r)£n any QtUW qzl QZ& QOl QÒC qem qes qawt r.e r-g r.p rbt rda rdb 0W1? rda owk. rdae owln rfay owle rgr ownz rgay owowv rhey owp. nb rtk owt. owwe rkl owwi rkiy owway rls owyuw rlu owOe rmey owep rnd owayk row. oways row/ owayw rpi zzi zziy zei zav zez ze? zaen zEye vz. ziy. vzt a.. v6e afe v6i ake alb veò ve? all alt viys WEt aly anh wEe wtd aqe WlJ ark wat arp ary weO wawa arz wayl aray 584 FIFTH GRADE 4 4 4 4 3 3 3 3 3 3 3 3 (con I.) (com.) (cont) (cont) (COOL) (coot.) (COKL) (cont.) (cont) (cont) (cont) (cont) or? Dt. az/ 36« a?ó emiy Biy. ó£ya óiya age ale alcy anl anp apiy as. atw avw aBiy a?d a?r a?8 awC. awke awme awnh awta awe. aw?s ay.d ay.k aydc aydr aydaw ayduw ayfa ayfiy ayge ayhe ayio ayk. aykf ayl. aymd ayml aymó aync ayn aysw aytow ayvb aywi ayz. ayze ayzey aye. ey.i cybey £y£n £yfr Eyge £yg£y £ykf Eykó £ylz Eyliy £ymm £yms £ymay £ym£y tymiy £yre £ysl £ys£y £yvi £yvr £ywiy £yye £yzb Eyzy £y6e £yel £y?. £y?t iV-E IV-? lyba iyClyCt iyd£ tyday lyfa tyfaw lyhey tyif lyit tyka lyki lykw lyl. tyld lylk lyls lyla lym. a.6 abd aCI a£t ad. ada afb ah. ah. al. amm an? apt apt arr ast atb att atg aOi a?l bdo bde biz ble bl£y br£ bra bst bse bas base baw. bayh bays b£yz biyd biyg biyft biy£y i.b Cme Ctay iep Ces iayl 6£ys Ciyd Ciyr d.l d.6 dboy dfa dfay dgow dhe dkr dme dm£y dng dnow drow dtw dtty dw(y dwiy djiy dzg dzh dzm dz& dav dawd dawt dayn dayt dayw daye d£ym diyb diyi diyr diyft diy? £.w £.ay £biy £Ce £dk £dt £dw £]8 £l£ £ln £miy £na £now £nv £n6 £pw £rk £rp Err Era EZ. EZZ Eer Ee? E?b E?1 E?m E?r £?e f.i f.m f.t fal fEr ffr fit fliy fown fra fse ft. fwEy fwiy fayh fiyz fuwl g.w g.e g£& giz gie gowk gn gar geb g»; gays gayó g£yn geyt h.d h.k h.y hawe hfyd h£y? hiyp hiya huw. huwh huwk huww huwz huwiy ida idh idw ifd tga igy ike ikj ilh imb inl inr inaw in£y ipi ipt iqa iQ/ inay iQiy iQ? isi ltd lt£ ituw iwaw i/d i/h i/k ijm i/t iez i?d i?r Jtk Jowk ]eg Juwn k.d k.a k.? kag kba kb£ kCe kdi kgu klu kl£y knEy kowa kray ksf ksy ksb ksay kt£ kwa kwiy ke. kag kal k£y. kiyg kiyow kiyw lk. Ik£ lm£ Ima lowz Ipa Ipi Isa Itr Itay iyc Izh Izi Izl Izw Iza lal I0i l&iy leg leí lew l»J lez laq lar lat laj layd layi layó laye lEyf leyó liyv liyy m.a m.r mba mdi mda mgr mit h.a UÓ • .£ 8-0 eb. e4a sd. •dg edn ega egEy eh. ehi eje elg emy em? epf esh esaw esuw etk etow ett ety evb eve evf evm evs eva eJE sOr e8aw 8?. e?b e?d e?g 9?» e?ay aba aCe ady adiy agz lyta .£r lyzE -f£ lyzj .fow lyzs .ga -h£y iyzó tyza ad tye. -im .10 lyes lyet -je iyaz -I® uw.l .kr uwbe .k£y uwduw -kiy uwki .lu u w k a .nh uwse .ns uwt. .na UWL .my uwtuw .owb uw6i .owh uwóiy -owk .owm ?.£ ?.l .owe ?.ow -p£ ?ar -pi ?duw .paw -p£y ?gr ?ki .r£ ?ka .row ?lu .ru ?n. .re ?nd .raw ?ow. .ruw ?sk .sa ?ti .ti ?to .tow ?wa .waw ?an .yow .yu ?eg ?ek .ziy -ed ?el ?ew .aw ?awt .ayp ?ayh .ayt l y m u w ?aym .£yp ?ayw .£yt lynf lynk ?iyt .iyw lynp aynz .iy6 lyns -UW. ij iyp£ ..t lyre .bow ..UW lysuw -CE a.i hal has h£? hid hi? hwe hed heq it. izr izz iziy i0b lOs lOy i&i 1er l-I l.k l.r las Ibow Iba Ibay ld£ Idaw Idiy leg l£m Ife Igow Ihi III lie me. mez mawd mawn mayw mEyb miyh miya m?e na. nak nbEy n¿. ní£ ndE ndow nhi nja nka nkr nk£y nle nnuw nowd now£ nowt now/ nowy nruw nsb nsp nsó ns£y ntl nta nya nzb nzh nzm nzt nza nóow ne¡ mm. nea mme naf mniy nak mpt nap msi na/ msow nawd mwiy naww naw? mzó móiy nayr TABLES OF 3 (COtlL) 3 (cont) 3 (COOL) 3 (cont) 3 (cont) nayz nty. ntyg ntyh nEyi n£yp niyi nuwy n?. n?h n?r ow.f ow.l ow.r owboy pak pan pat pit rfa rfEy rfuw rgy rg£y s-P 8.0 san sar sbaw s£e sdc sdcy sft sfiy sgc sgo sga sgcy skow skt sky skEy sla si a sna tba tba tbay tga tma tmiy towd towk towv tpaw U t tsaw tarn t6ow taf tawn tayw taya tEyb tcyl tEy? tiyw tiyz tuwk tuwr tuwj toyz ud6 uday udiy ukm ukty ul. ulb Ull ula umt utf uts uta ual uan u?a v.s vha vik viz PLI pliy pray pst psay pwi poz pfta peb pat pEyJ OWEV P«V» o w h a p«yy owhow piyb owkiy piyd owl. 0-d owh ija Q.k owls o w m . 0-r o w m . rjan o w m i y Qbu own. Q£l o w n g qga o w n t qgow owr. Qk. Qkl ows. rjkft owst o w s o w qkiy OWtE Qll owvE Qla qnc owvi owzf opiy Qpuw owzg owzy OQi owzft QSt owol ijtay owop owiy ow&ow rjan owab r.d r.o owef rbow owel rb£y owez o w a n rbiy o w a y h rboy oway] rC. o w t y . rdp ow?E rtg rfu P-J nj rjt rkf rlf rm. rmow rmz rm» rnc rnh may rniy rn? rowi rown rpE rpo rs. rs. ran rsr rtow ruf rva rwi rwo rzf rzl rzs rzay rob row r«d rftEy r&iy rah raO rap raq raj rawi rayw nyr riyv r?. r?k S.I SOWE sowf sowg sowi sows sowy sow? spa sra srEy sruw ssk ssm ssiy stm stow st& S3l soft s6i sOa sa. sEys siya siyt siyj siya siy? s?& t.f t.e VI? vn£ vag vah val TRIPHONES 58! 3 (cont) 3 (cont) 3 (cont) 3 (cont.) 3 (cont.) 3 (cont.) 3 (cont.) V8W zsi zsp zsay zway zzEy 6a6 taw b£yn eftiy eeg eak eer ees eas eav eayl eayn etyd e?h e?I e?p e?J add adg adl adr adz ade af. afs afw akr akw aky ako al. alb aik am. anb «nj asp i atb atf awbi awd. awdi awiz awmE awnE awns awse awzi awen ay.b ay.i ay.t aybay ayda ayds ayha ayji ayka aykr ayld aylE ayms aymj ay m o ayrfw ayniy aype ayr. ayr. ays. aysEy aysiy aytu ayta aytEy ayvh ayvp ayvr ayvs aywa aywow aywu ayzi ayzw ayeb ayeo ayeft ay?a £y.£ £y.g £y.n Eyit EyCEy Eydh Eyduw EygE Eygow Eyi? Eyk. Eyko Eyka Eyl. Eylb Eyle Eylay Eymb Eymk Eymow Eymp Eymo Eyni Eypu Eyr. Eyrb Eyrd Eyrh Eyrs Eyso Eytu Eytuw Eywow Eywo Eywiy Eyjiy Eyol Eyeb Eyep tyhaw lyi? tykow tylf lyll tymd lymz tymo lynm tynn tyniy (yowl tyowp viy. viyO WE6 WE? wit wol wak way. wEys wiyv Jap Jh£ Jig Jin Jia Ji? Jowm Joww Jwo J£yk JiyJ Jiyfl Juwz ytr ye? yuwv yuwo yuwa z-J z.z zba zbE zbu zdE zdaw zdiy zduw z£n zEr zfu zfiy zhuw zim zig zji ZkE zki zko zkay zla zpi ZOW zaft zaj zaek zaep zat zay. ziyd ziyr ziyw ziyz z?Ey odi odw of. ogi olg oik slay omay ont onr one ope OQW ore orf orj orw OS. ov. ovi OZl oen oer 3?( iliy 9d£y 9gr Omay OrE Oye 06e Oev Oiys 6E? &eow 6£yJ 6£ya 6iye.S e.r ebd ebz abo abuw 9tl e£uw add efa ef£y efuw egz •H ekt ekay •H elm ely alb emj env eow. epw epuw eneog eoe esr es& etg etl etm etj eta eva evd evg evp evz eviy ey£ ezEy eOe e&E e&Ey ctg ati aet6 ava avf avm avn avr aj. az. azi azw a?f a?i «?P aw.t fy?g Ey?& ly.p ly.r lyad lyar tyba tybl iyC. lyim tyCay lyda lydo lyfr tyfa tyge iypi typw lys. tysa lysw lyti tyv. tyja tyjow iyy£ tyzow iy6i iy6Ey tyeb lyeg tyeh tyek lyev iy£yb tyEyk tyiyv tyuws iy?t uw.b uw.m uwbr uwd. uwfr uwin uwis UWIZ uwka uwlw uwl6 uwlEy uwmE uwp. uwpl uwpu FIFTH G R A D E 586 2 2 2 2 3 2 2 2 2 2 2 2 (COM.) (com.) (conL) (conL) (com.) (corn.) (cont.) (cont.) (com.) (com.) (com.) (cont) uwrm -by ayv ata howt imf Jet k£yd -?h atow fha fig fu fie fla fluw fowl fwe fftiy fak fay faft fak fan fayft fEyr fiy. fiy. g-h g-6 gam gbr g£r gir gka glay giiy gnaw gowg gowr gowe gow? grt gra gsa gya gat gar gayk gayn gaye gayay giyr guwa h.ow h-ft h.a ham ha? h£v hip howp k£y. ath egs £h. £h £kd £kz £kô £lr £l£y £m. Emm £na £n£y £P£Pf £pm Eps £pa £00 £r£ £rm £ra £S£ £Sl £SW £sy £tb £t£ £tr £t; Ewe £wiy £;iy £Zl Ezn EZW E&Ey Eab Ean £?d E?E £?k E?n £?Z f.S f.a f-ay f.? fas fav fd£y fdiy feft ]us uyz dpr dru druw dst dsay dwa dwt dwu dwa dya dzb dzo dftcy dae do/ da« daem dat day. day. dayh days daya dcyb dtyg dcyi dcyr dcyv dcyy deyfl diyC diyh diyt diyy duwd duwf duws duww d?a £.1 £-y £.a £.a £86 £6. eda £db £dm £d/ £da £f. egi ilay -£fl CfE eu iin Cis Ciz eiuw Cmi Cmiy Cpiy Cftow Cfte Cef tag CeJ 6am È8V iej Cam Can iiy. Cuwg d.J d.p d.r d.v dap dat da? dba dbow dbr dday dek dem dcz dfr dfa dfiy dgi dgr dht dhi dhow dit dkl dlcy dma dna dnh dna dnay dowm howr uwrty huk imm Jaw k£yn hway imz laz k£yr hyuw imft lak k£yv ham imaw JEym kiys hal in; Juwl kiya ha? may Juwow kuwb hae ipl luwa kuwd IQC k.k kuww ir. k.ow La kap l.d I.E uwwiy uwju uwziy -ES -fy -?S att .fa .?a at; uwil .f£y .?uw ata uwa. -Oi ..aw avg -8« a.k ae. -flfy a-y aal -ll a.a a?a a-? a?f uwak uwaev ?.k ?bu -IV ?be -la aah a?r ?Ca -J£V ab. a?s Jiy ab. b.a -kay abz ban ?how .la aCa bas ?iQ ?iw -l£Y aCft bet Jiy adc bit .ma adow bluw ?kr .maw ag. bma ?m£ .ni aga bowl ?ma .nm agi bown ?ni .nw aha bru ?n; .na aj. bsk ?ne -ne ak. buj ?owl .nuw aky bz. ?pl .owd aka bef ?pr .owl al. be; alb bay ?de ?diy ?J8 ?n .ow? ?ray .pow all bar ?s. .puw alk bawe .ra alow bayb .sm aly bcyft .say aky biya .suw am. biyl 7te -low amb biyow ?Ay J w amg biyp amk biy; Ter -J£y .Juw ami biya ?aw? .yn amw buw. ?ayk .in amft buwt ?ayl -Of a m « baya ?ayt .aw ann bayiy ?Eyg .aft any e.d ?Eyt -•0 apa C.h ?8£ hi ?tr 7tu ?z. .ad arj .am e.i arow C.r .ad . K ara C.y .an .awd any 6.? .ae -ayay asi Can .a? .tyd asp Cdaw .bu -iyC asv i tu ham har h a w o w irl hawt i row kba hawz isn kba l.f haw? is; k£m Low hay. isa kh£y La hayb ise kii lb£ hayd isay kif Ibl h£y. is£y kip ICi hEyl ita kiw Idf hiyn itg kja Idg hiye itr kka Idr hiy? itu kli Ids i.n itw kma Idt lig it? kn£ Iday ifii ivl kowm ld£y itm ivw kowt lip iva kpa l£l iSt ivft If. itw i/y kra kra Ifb ksb Ifay idm izj izy kse •ga iff iza ksn Iga ife izay ksiy Igay ifiy iz? ktm lha igg law kta IhE kta lha idb ifll ie. lEa igr lOp kua Ihiy igt iBw kya Ihuw igz iftm kas igEy ifta ka? Hi iftiy kOi Ikr i?f kOr Iku kftow Ika i?ow kag Ikay ikEy i?a kak III ilc Ida kaft Ila ilf I£f kad Ila kawd Ina Uikf ikp ike \>10 ils lift ila i?g I£l Ikd J£n kaw? Inow I£? kayd Inay kayt low. Jit 587 TABLES O F T R I P H O N E S 2 2 2 2 2 2 (cont) (conL) (cont.) (cont) (cont.) (conL) (cont.) low. l?9 nbi naes own£ m.9 nbr nawa ownd P-? pbae QSOW lowb QSP IP- (cont.) (cont.) (cont.) rny S.J saem teay vfow rowf s.aw sawd tab vgo (cont.) (cont.) m.aw niuw nayj ownp pfay QSUW rpr saf sawt ta? vja Ipl mae ndt n£y. ownr phay r)w£ rr£ sak sayj tawe vnow Ipiy mbi ndu n£yb ownO pi£ Qwa rra sarti sayw tayg vowl Iray md. ndw n£yd owp£ pid rray sbae s£yò tayp vpr ls£ mdo n/iy ndy n£ys owpi P>l rsb sbiy s£y? tayr vpoy Isi m£d ndo n£yv owps Qye QZl rsg sCiy siyb tEyow vr£ It. mga n£m n£y? owpt Pi? pka Qzr rsm sdy siyd tEyJ vtr Ita mhow nf£ niya owpa pmay qza rss sdo siyp Itiy mjuw nfl nuw. owpa powr Qzaw tiy- rsy sda siyv tiyk vzm lui mka nfiy nuww owpiy powa l]3f rso sdaw siyy tiyp vzw lyi Izf mkae ngo nuwj owrp psa qOr rs& sdiy siyay von mkay nhuw nuwz owrs qad rs£y suwt tuwa v6a izg mli nifi pt- sduw tiyy nuwa owrt Ptl qak rtay S£. s?s tuwf vò£y Izk mne niv n?i owr0 ptm QaS rt? shw s?t tuwow vav Izm mnay niO n?o owre pts qayk ruk shiy t.aw tuw6 vat Izr mowk nj. n?6 owray pur Slf tbiy t?i vawt Izs nj£ n?ay owsm pyt rvd mpow Q?raj rway sir td£ uda vEyd Izy mpu ni« n?£y owsw pye ral rw£y S1V tdow udh viyd Iza mpa njuw OW.E ows? p&i raa rwiy sia tdaw udr viyk Izaw mpay nkl ow.ow OWtl paw rba ryiy skE t£& udw viyn vtay lof mse nkiy OW.D owtow paz rbo rza sks tfi uf. viyp be mti n m a owam owts paes rbaw rzh skw tfay ukg viyv leh mtr nno owbo owwo payp rbay rzm skDy ukz w.ay l®I lad mwc nowk owd. owzb Pivi rdn rzp smi tgt tgo ul. war mza nowo owdf owzs piyow rdow rzy smty thow ulw waj wis lag mzd nowae owd o owzO piyt rdr rzae smuw tip umz lem mzf nowiy owd6 owzaw piya r£l ro. snaw tjEy ure wiv lap mzg n r£ owd a owof piy£y r£t ro. sowa tk£ ust wiw la? mzl nra ow£n owO. piyiy sown tmuw usa wray mzow nra owfi owaw puwa rf. rof lawz rom spi tna ut- wul law? mzay nsd owfiy owaò poyn rfow ror sri tnE ut. wu? lay. mof nsn owgow owawt poyz rhow re. srs tnow Utl wof layl mom ntb owho owaw? o-n rhw r6f ssa tnaw utw weh layp mO e ntd owk. owayd mòae ntf owk£ owaym 0-P lays q.q r£z rhay rfliy stb towi utb wem ri. rawd std tpo ujt way waw. layv me. ntm owkl owayn Q-t rka ray. ste tpiy uje layw mef ntn owkr owayt Q-0 rkd rayl sway tru uer way. Ityow m a i ntp owks owiyd O-ay rk£y raym swEy tsae u?d wayf lEyw ma/ nte owky owiys qbl ri. rEyg sjow tsiy u?s wayz Icy? maws nv£ owkò owiyz QÒ£ rlb r£yj sjiy ttr u?w wEyow Iiya mawtì n/u owk« ow?b ijfo rl£ riy£ syu ttw v.b wEy; liyE maya nyu owl. ow?h Qim rb riyow syiy tue v.o miyr nzg owlj qka rlft riyo sa. tWD liyl miyz nzl owlk P-f qk£ ria riy£y SDQ v.e w£yaw liyi t/a v.a liyò m?m nzp owl 3 qkh rl£y ruwb sow tyiy V.? wiyow liyae n.ò nziy owlò qkm rm. ruwt soa tD9 vba wiyuw liy? n.J nof owmowp.m luws n.z nOaw o w m a p.n P-0 P-i P-k r?g wEy? wiyj qkn rmy s6£ tei vdo wiy? Qky rnm r?l s6ow te. vdaw ;.w J-6 J-e I7t n.aw nay owm? p.r Okay rns r?r sa/ tei VEV l?w nap neay owna p-6 qray rnt r?z saa tez vfi 588 2 (COOL) /-« Jdi /fa /id Jik JLD /ka /ma /may JOWL Jowz JoW D JV» jyuw J®« /ba Jab /ak Jam /at /a? Jaen Juwt ytw y£b y£aw yE? yim yia ynow yowk yul yar yof yav yaO yam yav yuwb zal zan zbiy zd. zdt zdo ztv Z£Z zf£ zftY zkl zkow zb FIFTH GRADE 2 2 2 (COOL) (COM.) zmow zm£y zne zni znl zns zna znaw zowp zpow zpiy zsk zaw zsa zsty Ztl ztw ztaw ztiy bow. bny bruw baj ban baa bawz bcyb btyy btyiy biyf biyk biyy biyey biy? 381 a.a 38Ô abm a£d ssiy otw aC£ aCa at/ ovj aiEy 3 W I aCiy awr ad/ ows adl ozh ad m azy adb 3ze adaw afow aa. oak aft 39? afu 3?t afa »18 afiy tua ags ego e-P 0.? ahy ebay ain ajuw Ois es. aku Osow akb akay Osa Owe ale Osd alu 9a. al/ Oah ale •mr Saw Gawd aown Says apb b£t apaw 6in aijr bit asb bi? as/ bmay asy ZWL z/ow z/a z/£y zza ze/ zaa zab zad zawd zayd zayh zayn zayw z£yb z£yd z£yt ziy£ ziyg ziyl ziys ziyt ziy? z?a z?b D.y o.a 3ba 3d. 3day odiy off ofy 3kl 3l£ Dtf sma ong onk onp onw snz amy opr 3QI oija or6 3sf (COIIL) 2 2 2 (COOL) (COOL) asO aaa atd atp atu ataw svl avn avr avt avw awl a/. a/a ayu azf azaw •8m , abr aba aad aal aat aay. aayO aiyk a?e aba at. ada ad£ adf adk ads adfy aff afi afb agi agow akh akm ake amb amb ank ana anaw apm atb as£ aaw aw?l as? atd aw?e ay.n atk atm ay.ow atn ay-/ att aybi ats ayba atay aybfy avb aydk aydn avk avp aydt aydw a/k azb ayday azg ayts azm ayf. ayfh azb ae. ayfaw aba ayfay aar aygi a?ay ayhi aw.h ayhow aw.t ayhaw aw.w ayhiy aw.b ayiz aw.a ayjsy aw.ay aykk awbaw aykl awCiy ayl. awdz ayls awda ay m m awnf aymp awni aymt awnm ayma awnv aynb awnw ayney awns ayre awna aysp awn? aytE awowl ayth awr. aytk awsw aytp awtb ayvd awth ayvn awt{ ayvb awtm ayya awtw ayzs awtay aybow awwa aybaw awziy aybey awal ayak aw?b ayat aw?i ayad (COOL) 2 (COOL) 2 (COOL) ayam Eytay ayayl Eyv. ay?m Eyvm ay?w Eyva Eywi £y.b £y.d ty/a £y.f Ey/i £y.h Eyzg £y.m Eyza £yan Eyziy tysn £yar fybr Eyea tydm EybE £yda Eybi £yds £ya. £yd0 Eyaa £yday Eyawd Eyayw £yfi £yfu Eyiyt £yfay Ey?l £ygi £y?a ly.n Eyif £yla tyal Eykb iyam Eykl iyap Eyku tybi Eyky tybu Eykz iyb3 Eykaw lybfy Eyk? lybiy lyCw £yi Eyli iyC£y Eymf iydg Eymt iydl Eymaw tydl Eynow lydz Eynw lydaw Eyniy lydiy Eyn? iyfiy Eypt lyg. Eyr. tygg £yrf lygk Eyn lygl Eyrp iyhE Eyrt lyim Eyray lyjEy Eysa tykb Eysp iylj lylm EytE lynh Eyth Eyty iyn/ Eyta lyny 2 2 2 (COOL) (CONL) lynz lyna tynuw lyow. lyp. iypa iypb lypa lyra lyrf lyrh lyrl lyrm lyro lysp lysa iyta iytf iyty iytiy tywow i V/a iy/iy lyyay lyzy lyz? lyov tyaf lyak lyayw iy£y. lyiyz tyiya iy?w iy?iy uw.r uw.t uwafi uwbi uwbl uwbay uwd. uwdl uwdy uwdEy uwdiy UWES uwf. uwfl uwfa uwga uwhay uwid ?ha uwim ?if U W L / ?la uwk. ?ka uwkw ?kl uwkiy ?kow uwld ?ka uwls ?la uwlt 7m» uwly ?m£y uwlz ?muw uwrru ?na uwmt ?nh uwna ?nn uwnt ?np uwnz ?n£y uwnay ?nuw uwowl ?n? uwown ?owy uwp. ?p£y uwps ?piy uwpiy ?ra uwr. 7ra uwrh 7a. uwrt ?sd UWt3 ?af uwtEy ?sg uw/ow ?sm uwys 7 8 8 uwz. ?83 uwz. Ttay uwiu ?t£y uwbEy 7 V E uwaj ?way uwap 7wey uwas 7/u uwa/ 7ya uwiyt 7zd uwiyb 7a/ uw?. 7a? uw?ow ?af ?aa ?-0 ?.r 7az 7.3 ?a? ?ay. ?.e ?bl ?ayg ?di ?ayn ?ayv ?db ?aye ?Ed ?fr ?aya ?f3 7tyC ?g£y ?Eyd (COOL) TABLES OF TRIPHONES 2 (coot) 1 l (coot) (coot) -OWj aye -iyy .owcy aya .UW. -pa .uwa -Oi .?k -0» .a .?l .«f .ay. 1 .an ..u .ar ..z .as .aa a.a .af .a» a.d .taw a.E .ah a.h .a* .tt -ba .ta a.m .um -bo a.n -buw .ua a.a .u? .b? a.a aC. .ea .va aCh .va -6a aCm -dty .wh .wy aCs -Ciy -du a£a at? ./m adk .cd adm -JY -£J adr .faw -Jo .fuw -J» adt -hu ady -yo adz .hy -yi adaw as -y* aduw .IUW -y» .zft af. -13 -Z8 afr .km .kn j€y afft .kow .3m afa agh .ka -aa .03 agn -kj .kaw -6r agz .kay -ftaw aga .low .aow agiy ahiy -my •J .n. .ay aiz .ne .aay "J -nd .auw alb .ar akb .nl .nn .awi akh .ays akj -np .ay? akr .nt akw -Ey. -ny -OWfl .eye aka -Oww -tyf ak? ?UW. ayJ ay.a oynd oyrrt ayzl ayal -OW2 1 (coot) 1 (cont) 1 (coot) aid all alw alb ama am] amr amt ama amay anh ank anow ape apf apk apl apy apaw apiy aoaq. arC art art ara aray aa. aaf aak aay aaa atd atf atl atp atr atv aty ate ata ataw atay atuw auk av. avd aab aad aan a at aaft aan a»yaiyv a?. a?C a?d a?h a?n a?ow a7p aTv a?J a?Q aTO a?aw b-p b.w b-y b.a b.? bab bal bat beg ben bev bea be? bga bit bib biQ bir bia bit bi? blow blp blay bowr bra bai but bu? bwa bya bz. bzl bzy ba. ba? bfta baa bai bag bah ban baw baft baay bam baq baft ba? bawl bawa bawy bay. baya bayf bayp baya bay? beyk beyn biye biyh biyy biyfl biyaw biyiy b?ay bayd bayh bayy bayft bayay a/m aJ6 aja aftEy aa. C-fl C.I i.m C.w e./ C.ft e.a e.aw e.ay Cap Car Cbi 1 (coot) Cba ecm ecft ee? Cfd Cfa ¿fay 1 (coot) d.cy dad daf dba dee deuw ddi ddr thy ega dduw dfl egc dfu ega Cha dga Chiy dga tip dha file dhaw (lay du Cloy dip Cnay div Cpey diw Cay dift eat djuw eaa djay et dka etc dkt etow dkw etr dlu etv dla eta dla dml ewi ewiy dn. dnb Cya dnj eak Col dnl eftcy dnn Cab dnt dnw eae Sew dnaw dniy tm1 dow. ea? dowe eiy. eiys dowg eiyw dowl eiya dowq Cuw. dowr euwd dowa euwf dowz Cuwr dowiy Cuwa dpa dpiy e?a drey d.a d.d da. d.a daa 589 1 1 1 1 (coot) (coot) dad dai dal dsn dta dte dti dtow dtu dtay dua dvft dva dva d/e d/ow dya dyiy dzk dzl dzy dzz dza dzay dam daa da? dOi dea d6a dac dai daj daay daiy da. dab dal dar daj daz daya dayf dayi dayp dayr deya dcyf deyk dcyl deyt deyj deyft eha £f El? diyl £/i diyow ej£J1 diyu £1 E/m Ezh diya Ejm diyay ek. ezl diyiy ck. czow duwh ckf ezt duwl cka czey duwm elg cz? duwow ClJ ce. duwr ell cfta duwO ela ead duway ela eak claw eal d?a Ems eaw e.a em? caa £-g e.a cnb caa eab caw. cne eng eal eawa earn enl cawiy caa enr EayE ebr cpg Eayh cba cayl epi it. Eayn £pft eeb epey Eayw tCi Eaye era erg Eiyt eel eet £?. £rl eea Erow E?a £66 Eru £?g E?h ede Ere ede Eray £?I edf E?V Eaa £?W edh eae edl car £?/ Cdn caa E?a edow caft E?? edp eaa f.b eda Eaay f.f eday Eaiy f.k f.l ed? Etf ccv Etm f.p Etn f.r cfd Etow f.b cfa ef? Ett f.a EtW fad egEty fan eg egk Etaw faa EV. fba cgi ega EV. fba Ewm fda ega (coot) (coot) 590 FIFTH GRADE 1 icon t.) 1 (cont.) l l (cont.) (COM.) fdi fdow f£k ftn fte ffow ffu ffa ffa fga fh£ fhw fhiy fid fje flaw fma fpr fpiy frow fro fraw fruw fsm ft. ftb ftr ft6 fud fwi fyow fOi fer fOay fa. fej faz faet fa? fawr fayg fayk fayl faym fays fay« ftyk feym f£yn f£yt fiyi fiyd fiyj fuwa f?h fayl g.m 9-n flJ BY 9? ga. gab gag gak gae gaiy gbc gbl gba gfia gdm 9£k gfe gfay gga Ofli ggow gguw ghaw ghuw 9if gie gka gkiy gla glow gla gluw gne gowa gowc gown gowu gowy gowiy SPl gra gsc gsi Bsl gam flap gst gsa flsiy gtow gte guk gun gup gu? gwa gwi gjiy aya gzb gzn gzow gzp gzv gzb 93gad gaw gae gb£ gba gem geb gaed gaen gaez gaeb gayh gayp gayty 9 ay? gey. gtyd g£yi g£yp g£ye giy. giym giye guwf guws h.b h.E h.h ha h-J h.l h.n h.p h.r h.J h.? han h£J hen hca his hia howb howg hown hny hud hw£y hyd hal haw hb£ ha. haf hah hat haw heft haa haeb hael haee haw. hawi haw] hawn hawb hawiy hay. hayf hayg hayO h£yi hEyuw hiy. hiyC hiyow hiyy hiyi hiyiy huwd huwn huws huwy huwb 1 (cont.) 1 (cont.) 1 (cont.) h?a i.r I.S t.w ilm lit ilw imd im£ imh imt imw imiy im? ipb ipm ipr ip6 i pa ipay ip? iqO ir. ird irg irm irn irt isl ISOW ISV isz tsae is? itk itl itm it; itaw itay itfy IV. IV. IV£ ivm ivs ivaw iw£ iwu ija i/f i/s l/W i/a i/ay ijuw izv lOf lOh i9v iej lOa lOaw i8? i&h i&r ifis lam ie6 ta? tuwh t?6 l?£ i?I i?; M I-k I-w I-y i - / 1.6 u ? i.. ib. iby it. iCf lih itl iCiy idd idf idk idl idow idj idae idaw l£r if. ifh ifs ifu ig¿ igf iflf igh igk ign igow igp 19/ igae ihay U. ika ikd ikh ikm ikow ikr ikw ikz ikae ikaw ikuw »11 1 - 8 I-? ]ba Ida Idi J£d leg If [id Jim Iiz Jma ]mi low. low. ]own lows lowae Jun Jze }ar 12a J6e I®I»£ Jaf Jav ]aa lab (cont.) 1 (cont.) 1 (cont.) 1 (cont.) 1 (cont.) ]aen Jaez Jayi Jayt leyJ£y£ I£yk J£yn ]£yz Iiyh Iiyy Jiyz ]uw. Juwa Juwi Jaym Jayr k.a k.f k-9 k.l k.n k.u k.z kam kas kaj kbi kbow kbay kit kdu kdae kduw k£. k£d k£t k£v kfl kgr kg& khi khae khaw ki. kjow kk£ kkl kky kka kluw kmow kma kma kma kna kni know kny knaw kowi kowk kowp kowv kowf kpi kraw ksa ksh ksaw ksuw ks? ktb kti ktd ktj ktk ktow kts kte ktft ktaw ktiy kun kwa kwu kway kfi k/iy kz. kzl kzm kzr kzt keg kOa kftty ka. ka£ ka] kaq kae kaay kaei kaek kaes kaee kawb kayw k£yb k£yi ktyj k£yk k£yl k£yt kiyb kiyd kiyj kiyl kiyn kiyr kuwn kuwp kuwa k?. k?b k?d k?w k?y kayy i-g l.p Law l.uw l.ay laj laq laa Ibu Ibay Ida lécy Idb Idd Id} 1dk Idl Idv Idy Ida l£P 1er Ifa Ifd Ifl Ifa Ifa igi igr igz lg£y Iguw lha lhaw III liw Ha IJt l]ow U» Ikb Ikm Ikw lie lla llaw Imz Ima Imfy Ina Inaw Inuw Inay lowb lowg lowi lowl lowm lown lowt loww lowiy IPIpt Ipa Ipay Irt Irow Ire Ira Iraw Is. Isg Isu Isw ls& Isa ls£y Ituw lus lua lu? Iv. Ivi Ivp Ivy Ive Iwa Iway l/a 1It lya Izd Izn Izz Izb Izay lak law Ibt le. laow laq leiy Ia7 law. lawe laye lay! layt layz laye laya l£y¿ l£y£ l£yr l£yy l£ya l£ye liym liyj luwd luwg luwn luwt luwy luwz luwa luway 1?. l T A B L E S OF TRIPHONES 1 1 (cont) (cont) l?B l?l l?ow layd m.t m-z muy maf mas mbc mbow mbr mbaw mbay mbay md. mdl mdm mdr mdu mdcy meg mek mfv me» mfr mfo mfay mge mgi mgl mgu mhaw mhay mhty mi. mi. mif mij mim miw mi6 mi? mkc mkr mko mía mi» mlcy mm» mma mnz mowl mown mowt mpa mpd mp£ mpf mpm mpa mpft mpíy mpuw mp? mn mray mny mruw msa msb msk msm msa msa mscy fntí mta mtty mu/ mvow mwo mway m/a m/i my. myt myn myu mzh mzk mzn mzp mzs mzy mzz mza mzS mziy mas mav maw meh maw 1 (cont) 1 (cont) mefl nCiy ndb me? ndd ma. maef ndj maj ndl mal nda maw» nc. maw? n£d may. n£s mayC n£? mayi nfy mayow nfuw may/ nfay mfy. ngl m£yn nge mfys ngay mtyv ngty mfyft ngiy mfyey nguw m£y? "nh£ miyfo nhow miye nhw miyg nha miyi nhft miym nh£y miyp nie miyw nju miyj n|z miyiy nj* miy? nJ6 muwn njay muws nj£y njay m?a m?i nk. m?ay nkm m?iy nkaw n.a nkay n.v nkuw n.£y nkay naf nía nli nag naiy nlcy nmow nbc nbow nmw nbu nmuw nba nnk nbaw nnp n£g nnaw nowf nCi nCr nowg nfit nowow nfiíy nowuvt 1 (cont) npow npy npaw np£y nra na nra nsg nsl nsr nsy nsa nsuw nt¿ ntj ntow nway nw£y n/a njow n/y n/£y nyo nza nzf nzr nzs nzz nz6 na. na. nak nam nap na? ne. n6b nOg n&r nti na£ nei nal nam nav nay na« nawb naw£ nawh nawi nawl 1 (cont) 1 1 (cont) 501 1 (cont) nawn owgay owr6 naw/ owgiy owny nawy owh. ows. nawa owhi owsd naway owhm ows£ nay£ owha owsg nayow owhay owsk naya owhuw owss nayuw owim owsiy nty¿ owiz owta n£yf owjuw owtm n£yr owkh owup n£y£y owki owv. niya owkk owv. myn owkm owwa niyow owkow ow/u niyu owlC owza niyj owlf owzh niyuw owlg owzk niy? owll owzm nuw£ owlp owzp nuwg owlt owzz nuwh owlw owza nuws owlG owza n?£ owla owz? n?f owliy ow6b owma ow6g n?a n?aw owmf owOr n?iy owmi owet n?? owmy ow66 nayz owmz owOiy ow.v owmcy ow6. ow.e ownb owftay ow.iy own£ oweg owah ownj owek owar ownk OWN owba owns owav owbaw owna owab owbiy owna owa? owfi. owowl owayl owCi owpl owaya ow£e owpw owayO owdiy owpy owfyd owduw owpay owiyg OW£l OWQ. owiyn owEr owog owiyp owfc owr. owiyt owfa owra owtyv owg. owrC owiyO owgf own owiya owgu owrn owiy? owgz O W R owuw. (cont) 1 (cont) owuwn ps8 ow?. psft ow?a pte ow?C ptf ow?w ptn ow?e ptu ptw P-b pte p-d p.h ptay pub P-l puC p.s pwty p-y p.a pya P-e pal P-ay pas pal peí pam p6iy paf pas pb£ pag pbo peh pC£ pay pe6 pda pa¿ pd» p£d pak P«k paj p£p paz pa? pe» p£v paw? payd pe? paym ph pgow payr phi pays peyPH ptm peye pts pey? piz puw. pkr puwd p?m Pli plow p?e pm. 0.a pma Q-e pmf 0-J pml 0-1 pmn O.ow pni 0-8 powg 0-aw powl 0-? pown 0b£ prey Obi pruw Obr psn Obaw psw Obay 1 1 (cont) (cont.) Obey Obiy OCv Ofi Ofow Ofey 09ogi ogw ogz ogey Oha Oíd Oif Oik Oiz Okd OkJ Oka Oka Ole qm. oma oma omay Qnow oowl opey ooe orow rjru Q&l 0&ey oe. oeg Oew Oez oad Oaf oat oa? Oawd Oaw? QayI OiyC Oiyw oiyz o?ey r.a r-J r.e r.aw ra. rad rat rbl rby rCf rfii ríe rdf rdt rdw 0S£ Qsm rdy rday Ose osay r£r r£v ote r£iy Oti otr r£? Qtu rf. rf£ otay rfm 0/e rgl oye Oyow rhu oyuw rha rig orf Ozg n¡ ozow n& Ozt ríe rjiy QZW rk£ Ozy rku Oza rky oza 562 FIFTH GRADE 1 1 1 1 1 1 1 1 1 ! 1 1 (com.) (COOL) (conL) (cont) (cont) (conL) (conL) (conL) (conL) (conL) (conL) (conL) rkaw rfcay rfcuw rlh rik rlow riw rlaw rtuw rma rmb rmf rmw rma rmaw rmuw rnb rnn rnp rnz rno rnfl rowm rowij rows rowft rpu rpey rpuw rra rrow rro rruw rsf ral rsO rauw ra? rta rtd rth rtm ftp rtw rte rtó rta rtty rup rut rue rv. riyh riyi nya ruw. ruwh ruwk ruwn ruwr ruwaw r?. r?a r?d r?p r?w r?iy s.d «.iy sa. ree sag rflay sai rag sao sa& reo rey sae ree aba sbe rab rad sbl s bow raf sbu r«I raz SCl aCuw ra« rawm sd. rawz sdd rawa sday rawiy seg rayb sfa raye sfu rayf sfy rayg sfa rayh sfay rayp shaw rayo shuw rayy si. rayo sib rayaw sig rayty aja reysk. rey. skb reya skh reyb alo reym •mow reyw smey rey; snc sowz SOW 3 sowa spay art srow ara aro s*d ssl ssp asa ssy stf stg stl atp sty sum sup sve svay avty swa swu swa s/w s/uw sza sziy S3. S3£ 808 SOV sea a&i s&ey sftiy sen seiy saf sao sa* saws sawe aayf sayh sayi sayv sayy saya sey. scya seyd seyf seyh seyj seyn seyt seyv scyw seyy seyz seyo sey5 seyay aiyf siyg siyl siyl siys stye siya siyaw siyey suw. suw. suwv suwft S?. s?d s?e s?f a?h 8?OW s?r s?a t.e t.e t.ow t.r t.v t-iy t.uw tad taf tbl tbaw tbey tea tCiy tda tdr tda tduw teg ten tet tf. tfa tfl tfow tfu tfa tfey tfiy tgr tgu tga tha the thi thw thaw thuw tie tU ti» tja tjuw tjoy tkl tka tkay tkey tkiy tie tlu tlo tla tla tley tliy tmow tnay towj towm towr towz towa tpt tpey tre tsz tae tsuw ts? ttl tts ttay tuy tue tu? tve tviy tjow tja t/ey tjuw tya tyt tog tea teaw t6r tea teow t»Q tae t»a tag tasq tas tat tayh tayi tayl tayt tayv tayo taya tey. tcye teyh teyn teyp teys teyz tey6 tey* teya teyuw tiyd tiyg tiyl tiyt tiyj tayo taye tuwc tuwo tuwa t?. t?d t?ay t?ey u.f uba uCo ude ude udl udp udt ude uda ud? uf. ukh ukk ukr uku ukw uke ukey uk? ull ula uly ulz umd uml umw uma umcy un. unf unow unt una upi upl upr ups upt ur. ur. urf urk urw urz ura urcy uny us. usg utd utk utm uty u/. VCl vet vfa vfl vfr vfo vgl vgow vga vgay vhe vhi vhiy vib vi d VI1 vka vki vkl vko vlo vmey vnay vn? vpo vpa vpey vpiy vpuw vru vre vra vray vruw VSC vsw vso vs6 vsa vsay vsey vsiy vta vtey we VWl vwiy vya vyu vyiy vzd vzh vzow vzs vzy vzo vz6 vzay vor v8r v6ow v«f vol VN vaiy vaf vag van vawa vayd vayt vays veyg viyb viyC viyh viyi viym viya v?a voys w.m w.w w.o was WCJ wcaw whe wig wil wip wia Wl? wlow wlay wmay wna wow. wow? wun wua wua wwiy wya wya worn waf wat waj wap waq we2 waa waay wauw wag warn wan wayc wayg wayh wayi waym wayv way/ way& wayay way? weyi weym weyp wey6 wiyiy wuwj w?e woyy J-b J-f J.n J-Y Jboy rve rvz rvóy ría r¡t r/u r/B rya rzb rzk rzz rzaw rog rop roz ril r«. (6g U/l u/l uyuw uza U». ue. uah uez ua? U?l uTt u?y u?6 v.d w.e v.f v.g v.h v.m v.n v.w v-J v.y vad val vbl vbow vbo vba vbaw vbiy vd. vda vdb vde vdn vdow vda vdey vduw veg jei /da Jfo ffuw Í9» Ii. M Jim Jir /it /ka /ko /k» /!• Jiiy TABLES OF TRIPHONES 1 1 1 1 (coot) (COOL) (COOL) (coflt) Jml /mi Jow. Jowk Jowy Jow6 /owe Jowa Jny j« ;»iv jtJtm Jtw /to Jt6 n* Jwiy Jor Jow /•- y£v ytJ yte yta yo» yin ynyow. yowi yows yowt yu. yud yum yun yup yus yua y*yziy yon yos yow yaz yai yaj yat ya/ yay yaf yas yaw. yayd yayí yuwfi yuwow yuw? y?» ZQ£y zho zhay zhíy zir zja zje zka zku zkoy zla zlíy zm. zmi zmy zmo zmaw zng znm znuw zowk zpo zpa zra zru zro zra zrcy zsa zaó zayt zayg zayk zaym zays zayz zayO zayft zayuw zcyti zcyr ztyw ziyf ziyh ziyi ziyow ziyv ziyy ziy6 ziya ziya z?. /•fl Jah Í-9 Jam Jaow Jayd Jtyt Jiya Jiyt Jiyf Jiyow Jiyu Jiyv Jiyay Jiyuw Juwd Juwr Juwi Juwt y.a y.m V-» yaya. yan ya? ydr y£b yt£ V«i yck Z-E z-íy zby zbey zCi z«a zd. zdf zdw zde zd zfa zfh zgay ZM zsm zsn zscy zsuw zta zta zvc zva zwu z/u zjuw zyzam zor zov zOow zea za6 zaf zag zas zav Z?l z?n O.l 0.6 o.a obl oCiy od. odj oEn ofr oft ofa ofiy og. ogn ogr ogw oga oim oin 01Z 01? ok. okf okg okm okz ok& 1 1 1 1 (COOL) (cont.) (coot) (coot) ok? ola oie olh oln ola olaw oley om. om. omb omh omi omow omw omz orna om? onv ono on a oncy on? op. op6 OQr oqs oqz orb orr orj os. osd ose osg osw otb otf oth otk ote otay ovo oz. ozb OZE ozl ozm ozp oziy obi o&a oag oav oiyz 0?. o?b o?f o?a ÍES llz 2wu tas 2aw tuwe e.a e.b «-9 e.h e.t e.y e.6 e.a O.iy 8ap ebt Obi 8biy ecz Ofa efi efr Ogi ehi ehcy 9ik Oim 9it OmE eow eoa 869 e&iy eaf Oag e«i Oap Oaq Sss 8ad eak 8iyw Oiy? e?. &iye 6iys 6iyJ a.ow a.v a.ty a.iy aar aaa aby abft ae. s¿n aet aew &.W otb 6 m i Orna eowi eowe Opa epiy en Ort esp etay Ova 9w£y eja eoe Oor adk adp adw adz a£r a£t afb af£ 6tk aff 6im afh &IZ afp afw bia 6miy agw ahr &OWI 6owJ ahu 6n ' ahw &rw aim fts. ait aiz &S8 fttiy ai? &ya ej. 68 r oj. aja &&e a]u 6a. 6ao ajay ajoy 6aay ak. 6a£y &aeh ak. 6awd akg & 8 W 8 W akuw &ayk alv 6Ey. aluw 6£ya ami amv 6Eye 6íy£ aowp 6Eye aows 5.. 6ba 6E. 6Ef 6£h 6£l &hi 503 1 (coot) 1 (cont.) aowv aOow aoww a06 aoway aOiy aowuw a6b aow? a6m a6y ape a6aw apd apk aab apm aah ape aap apoy aaf aan aoaqb aat ago aa? aqO aay. are aays ari aayv asj aayz o£yg atb atf aiyl atn aiys atuw aiyy avk aiya avow a u w w auw? avay avfy a?a av? a?£ aw. a?f awn a?ow a?r aww awy a?o awa a?£y awuw a?iy aw? a?? a.n ajejb a.a abi *fl abl ajg ejr abr ajo abay ae. aJEy aCrn ay. ae¿w aya xtb ayi ayow a d l eyiy adn adow ay? aze ada aof aday 9lt afow eíi afp aOh afe 1 (COOL) afa afaw afiy agd «ov aega agiy ah? «H akb akd akg akk akj aka akiy akuw alg alow alz amd ami amj amm amn ams amy ame ama amay asna anr ane anuw aow. ap. apn apt apy aq. aqg aqq asd asE asf ash asy ase as6 asiy atl atj 1 (conL) atEy aetuw at? avh aw ave avEy aje ají ajt ayz az. aezh azk azs azt azz aziy az? ae& ais aaf aap aas aet aa? auw& a?g a?l aw.p aw.s aw.J aw.y aw.a aw.? awbe awboy awey awdh awdk awdl awdow awds awdt awd6 awda awEn awhiy aw}e awka awlE awle FIFTH GRADE 594 1 1 1 1 1 1 1 (corn.) (com.) (cont.) (cont.) (cont.) (cont.) (cont.) awmm aw?r ayls ayvE EykEy £yvy aw?a ayliy ayvy £y-I awna £yvz awnb aw?? aymb ayvae Eyla £yv& awng ay.J a ym h ayviy ty-i Eykiy EylE awnk ay.r aymj ayway Ey.o a w n o w ay.y aymk aywiy £y.£y awnr ay.O aymaw ayjiy awnay ayam ayna awniy ayar awra Ey.k Ey.v tylo 1 (cont.) 1 1 1 1 (cont.) (cont.) (cont.) (cont) tyau lymae iyz6 iy?d uwjow lybE lynd lyzay iy?£ uwk. lyia iynj iyzEy iy?f uwk£ Eyvaw lyib lynl tyod Eyjow iyt£ iyn9 tyof iy?h uwkn iy?g uwkl £ylh £ y y£ iyCp lyow. tyok iy?i uwkow Ey.iy £yll Eyyi lyis lyowi lyan iy?k uwkr ay/uw £yav Eyln Eyyu tyèae tyowk iyop iy?m uwka aynf ayy£ £yb. Eylr Eyyae iydb tyows iyo6 iy?ow uwkay ayba aynh ayye £ybg Eylw Eyyuw tydd lyowv lyoiy iy?Ey uwkEy awrb aybu aynl ayzh £ybi Eyla £yzf lydp lyowe lyii uw.a uwkay awre aybo aynm ayzk £ybl Eyma Eyzm lydv lyp. iyO£ UW-Ó uwla aws£ aybiy aynn ayzl £ybw £ym£ £yzn tydw lypk iyOs UW.E uwlb awst ayCi aynr ayzr Eyba £ymh £yzt lyd/ lypow iyO& uw.f uwlf awsr aydb ayzt fybae Eyml £yz& lydy lypaw tyOe uw.g uwll aws& aydf aynf ayn8 ayzy Eybay Eymy £yaw iyd6 iypEy lyfliy uw.h uwlu awsay aydg aynft ayzz £yè£ EymO Eye. iy£d lypoy UW.l uwla awtc ay d m aynae ayz& Eyda Eymae Ey6m iy£g lyrd iy60 uw.p uwlae awtg aydp ayowl ayam Eydb Eyna £y8o iy£j lyrk iy6iy UW.8 uwliy awtl aydv ayowp ayon £yd£ Eynb Eyftow iy£k lyrp iyej u w j uwmf awtr aydy ayowiy ayar. £ydk Eynd £y&Ey iy£s iyrw tyew UW.3 uwmk awtt ayca aypa ayow £ydl Eynf £ya. lyfE tyrft iyej uw.8 uwmn awtO ay£m aypb ay6r £ydn Eynk lyey uw.ay uwmr ay£i] ayp£ ayOa Eydu eynp lyfg lyfow iyr£y awtc awt? £yad tyet lys. lye? uw.iy uwmo ay£t aypt ay&i £ydj Eyns Eyav lyfu tysd lyaeb uwan uwmb awwiy ay£? aypr ay&ae £yd? Eyny Eyey lyfw lysl lyael uwba uwn£ awjiy ayf. aypy ayeg £y£m EynEy £yaz lyg. tysn lyaet uwb£ uwmy awye ayf£ aypae ayel £y£v Eynuw £ye& lygr lys/ tyaeuw uwbu uwnuw a w y u w ayfi ayot ayaef £yf. Eyp. Eyes lyga tysEy lyae? uwbEy uwow. awzk ayfj ayra £yfa Eye? lygae lytd lyawt uwbiy uwowv awzs ayfl ayrp ayseg aysk £yps Eyaet lygay lyud tyaw& uwCiy uwpE awok ayfu ayra ayaeq £yfl Eyrk Eyav lygiy lyum lyay. uwdg uwpi aw®. ayfo ayraw ayaes £yfo Eyrl Eyayd lyha tyu? lyayg uwdn uwpe awO. aygu ayruw ayae? £yfe Eyrm £yayg lyhow tyvE lyayh uwds uwpae awOw aygo aysh ayawt £yfaw Eyayu tyhw lyvg tyayl uwdo uwpEy aw&ae aygft aysk tyjow tyvh lyayy uwdaw uwrb aygty aysow £Vfl tygf Eyaye aw&€y ayay. ayayh £yr/ £yry £yrae £yayx lyjae tyvl lyaye uwf. uwrd aweb ayguw aysae ayayk £ygs Eysh lykr lyvy iy£ya uwfi uwrf awes ayh£ ayta aycyc £yhi £ysw EyEye lyky tyvo iy£yd uwft uwrg awew ayit aytb ay£yt £yho £ysy Eyuw. tykaw tyvaw iyEyg uwfa uwri awei ayju ayuwi £yhiy Eysay Eyuws tykay tyvay iy£ym uwfae uwrow awaws ayjuw aytg aytm a y u w t y ' £yiz £ysiy Ey?f tylh tywi iy£yr uwgi uwrp awawavaykfi aytn ay?d £y?v lylow lyway iy£yw uwrr aykd aytr ay?£ £ytf Ey?y ly/u uwgay uwrs awiyg aykh aytw ay?g Eyji Eytg £y?e lylt tylw ly/ae uwh. uwru awiys aykj aytj ay?h Eyjm Eytn Ey?aw lyl? ty/uw iy£y/ iy£y? uwgu away« £yj Eytd iyiyE uwhE uwrz awiyz aykn ay?k Eykh Eytow Ey?ay lymk lyya lyiyi uwhow uwra aw?. aykow ayty ayto ay?l Eykk Eytr ly.C lyml lyya lyiyr uwhaw uwre aw?d aykz aytft ay?s £ykm £yto ly.ow lymm tyyaw lyiyy uwhEy uwr« aw?£ aykaw aytaw ay?z £ykp EytO ly.w lymow tyzC tyuwh uwhiy uwrEy aw?k aykay aytoy ay?se Eykt Eyvb lymu lyz/ uwtf uwsd aw?ow aykcy ayuz ty.a EykO Eyvt lymft tyzz UWI& UW8ITI £yf£ EyiO £yp£ £y£yt iy-iy tyan iy&- iy?. iy?b TABLES OF TRIPHONES 1 (coat) (COOL) 1 UWM UW?. m m uw?n UWttW ?.J uwscy T.u uwb T.ty uwtow T.iy uwtt 7aa uwta ?ah uwtay ?sm uwtoy ?av uwv. ?a6 uwvb ?•? uwvt Tba uwvf ?bc uwvt ?d. uwvfc Tdd uwvz Tdt uwwt ?day uwwowTtg uwwu ?tk uwwiy ?tl UW/I ?ct uwjo Tfa uw/ty Tfl uw/ty Tfay uwjuw Tfty uwyt Thy uwyu ?ga uwzp Tgi uwzy ?gs uwz6 ?hw uwad Thay uwal ?hiy uwop ?ij uwow ?im uwlw Tku uwiuw Tk£y uw6a Tla uwOaw ?la uwòc ?m. uwaf ?m. uwah ?ma uwav ?ml uway ?mm uwan ?mp uwawd ?mo uway. Tn. uwayz Tng uwiyd TnJ uwiyk ?na uwiyz ?nw uwiy? Tna 1 (COOL) Tn8 ?n6 ?na ?niy Towa ?owt ?owk Towt ?owa ?P* ?pi ?ru ?rty Tal Tan Taow Tau ?»; ?aaw Tta Ttd 7th TtJ ?tw Ttn ?tow *y Tt& Ttaw Tvz Twa 1 (coot) ?»yf Tayow Tayp ?«yz Taya TayT Tty. Tcyb Tcyn Tcyr TeyT TiyC Tiyt Tiyg ?iy) Tiya Ttyz Tiy6 TT. TTa TTa TTiy Toy. ay.h oy.n ay.a ay.w ay.8 ay.ò ay.a oyde ayda ayhuw Ty£ oyi?zf aymm 7zh oyn. ?ZL aym Ttaw oyn m oynn Taf Taf oynj Tav ayny ?DW ay«. 70« ayya Ta. ayya ayyuw Taf ayzh Tav ayn T«y Tae ayza ayz/ Taa Tar ayzS Tal ayzò Tawd ayziy 1 (coot.) ay6c ayag ayayw ayiy. ayiy» 8.9.4 Adult Tables of Triphones Adult 245 ..w 217 -ay 207 -Y 1% t. 192 r. 190 6iq 189 .aen 170 .we 167 -WE 155 .en 152 wez 151 n.. 147 ftEr 6a? 146 .ye 134 layk 133 z.. 127 -6 ers 126 ..e 124 W£l war iy.. 121 enow 120 -V £ 119 yen 116 .yuw I®« ver 115 s.. 114 now. 109 ow.. sem 104 .be fer 103 ken er. 102 -6e en. 101 ste ter 100 ..h 99 6art 90 6er 89 73 den 87 der 84 down yer 83 m.. 82 1.. bis 80 79 93 92 a? ..ow 78 ..n 77 ine 113 91 wen .6« iqk .now .eh ene i0- 111 haev 74 88 94 ..* est ens .6Ey ebaw er. ,.i iniy .ayd w£n yea 98 75 76 UW- 62 ere efte Twe 61 int zen 72 60 now. -aym wed ent erd ?ts eh. 71 59 wi8 one 58 £l. 70 d.. miyn bed riyl 68 57 .in nde Q-skuw nte erft 67 kuwl 65 iij. ren 64 erz 62 .ayw ..s Eve fen egow erk 52 56 iy®i £y.. rawn 41 37 46 pity rde eh« enn .e. .er del i?t pel yuwn ert ay8i g « mat 40 end xn. aywe 51 45 £St £ wr tst b£n ike mOi n&f v£r e.. eze ale abty am. ..d ow.ay 49 lyliy 48 .&£ t£yk tde its en. we? ele enft erl aen6 -hiy 47 at rse ern nyuw ted ten ven £riy 54 (cont.) baw? did for haed par nye n&e 38 (cont.) .if 50 ayke type lywe 44 iks ner w£r emO aydow teg art ayhae 39 .haw -Wl piyp taym £a. kal kaen el. aymiy 38 43 Ent "el laes tse az. fre k.. n£v be. em. ede erf 36 be? hiyr IQZ rem «ti ayde l?W 42 a.. ard diq kin men -di fa. .ow. ler wriy 598 34 42 (cont.) dye .sow 55 47 (COM.) .wiy Er. ..b ?.. 53 (conL) in& it. sar wel aday emE orb as. aend 35 .ayG m£n ntuw agE anw aniy ave xva 34 dev gt? in. ins kaz n&Ey rdiy sen wat 6am ela eme art. 33 nna ntr nas r&e sez tin &et ahe ejiy any 32 .ayh ada bawt ¿er dep £r. gud gon nat nan rin ts. tab wan eduw enay an? ev& aeda 31 .hae -ay. bin kid kem rirj rwe &es ediy ayk& ly.a 30 .se Ede fte ify ii)e l?S kte nnow per sayk tez.e erw araw eyuw aylay 29 .may .ayl .ayn ber din gowi in. lad nse net r.e TABLES OF 599 TRIPHONES 14 29 26 24 23 21 20 18 17 16 16 IS (COOL) .fa .te dad kol kba lid n.w rz. stEy yah yuw. be? ed. enz arh atr e?. ae?t lygr lyh a (COM.) (conL) (cort.) (conL) (conL) (COOL) (conL) (COM.) (conL) (conL) duwi £ny gat grty ini las Uy. mowr nam niyg rz. rab rayd tuw. yuwl baf bah adi aynd aysc aysk Eyha OW.l en£ erg erp aw?b lybe lyCe lyin lyr. iys£ uwl. uwla ?se ?te duwe fie {rz fyuw idz iky inn ive kayn layf mcs na ni? nst nek Prfe rtyt diy. Edi Enb frt her hap ifay ISl iti ki? lay? Iiys mEyk nEk ns. nayt Oke rtyO SEk sfe stiy swi siye t.w tra tsj tek tes /•I z.w z.ay or. ben bEyg biy. e.y e.ay enb eni eno est osi etE etiy ezb ann awt. ayje lydi lynay lyrz uwke ?bfy tayp wiC wim zwa zeb agr akl epiy eray esEy e?w aia ani a?w ayko ayt. ly.w tyel ?ba pE'n Ok. rab ad rer ayb t.e tik tst tew vin vye Wlb wiyd wiyh yed z-y bas eCe ed. edr ehow amb enk ena enEy evi ezs ast avt awte aw?. aym. ayOo Eyje lyli lyst tyze ?.w rye sik no vbe yuwk bek bap bEyr •we aft ats 28 -biy Jay -tUW nliy nab owva rayt St. tei wud wiyk zbe •pa any ats aydi lyn. uwnow 27 -Ol grow it. koz lam nin ownl str tny yiyr 6in 6riy 6£y. aka aliy ans uwl. 25 8S9 at. ant aygt ayw£ .hw .ke di? 23 Ere .am kla biyk liv dis lye n.b cks ekt nit owld gar rze hwa sin ham hiyz tray tiyfi iQi tuw. ler yea lav mows y»g yuww mar olft sow. 3rd tuwa bab zar elay a.w eni a.b ate a.e a?. al. apr aykt aynow art as. iyja ata 24 az. bat e?b 22 -na dij dab f.. fen hays idiy iijt is. iza l.i nwa nap owwe res swa sap tev yuwg ora b£yh ali ang ape arm et. 8W3 ane ay.ay Eyke 21 ale bel dyuw de. dey dawn gowt kst layn Uy. mm ne. neb niyfl ow.b owiq own? r£n s£d twe ude yuw. b£yw a.s ami en8 ery tyke 20 .Je .ayk ..m ..0 bak biy. fiyl haf ije 100 isk iz. kor ket ka? I.b l.e len mba mis mor n.a na? nje nOi ow.e ran s.e s]a St. un yuwd yuwr arm ore nwiy nba nef neg nays niyw ownn owte Qte r.b ryuw ay. riye siz 19 sowm tar .bi .de tok .ayv teb SU tiyn ate sta yel bik seb olw End san or. giv Oruw t-y tem IQb bcyd b£yk ks. tet wan Ibe biyz yuwm e.in.a owst yuws ebi pra z.b ebe zin rte efe bew ny. esiy s.b eti epl t.b epb etay tre at. a?. teh lyks a?s tuwb tyve ayna bowz Eybiy 17 Eyki bed .iz edy Eywa anh lyde -Jiy ask ark lyz. eOi biya ?.ay «nay Enn 16 uwwe fye uwbe Ida .duw luk .ray ?be Ityd .St 18 miy. .£v n.ay -ayg ..k blay nio ..r noww d.ay nowb d a ble IS -siy .or .eb .et .ays ane big dif dem des duw. Elf En. En? fowr gow. gen howl hiyw idi iz. IM kal kio l.ay loo lEyn lEys mes nlay nnt nowe ned ow.w owin pa rd. rtl rki rst rbE res SEI ske sor sbe tES tWE tbe 14 .m£y .e? ..a -S -I ..1 bed boi dik dit def diy. £lV En. Eri fayn hiz inf ino izn lOi lab kse mem nd. nduw n£n nbiy nayn my. n?s 13 .sa -tw ..t abl ar? bór bawd e.. daz Elb try ADULT 600 13 13 12 12 (cont.) (conL) (cont) (COflL) ítl fiz f9l gr» hiys inl ita ant ad6 aka amp arc aya a?s a?a aw.. ay.. aymg ayta iy-6 tyna tyan tyar uwha ?be Iwa lab liyv n.s n.y nfr nge nha nney nniy nowi nriy nai naiy nta nwt njiy non nal neym ow.y p6e Q-a r.w r-V rdi rka rma rna rowz ral rat rav rayv aen soway sel t.b til towl vio val wiz yayas zio zriy bal ábl afr •fo anl anm anp anr av. away amp asa avy ayk. eyt lyr. lywey lyba tyav uwtq uwsiy ?.& ?si Ttuw 1?. kar k«P k/a kap kiyp liQ Iwi 16« mcyb n.n ndi nhiy njoy nz. naw. n?. owme pre pud pan Qin Qki qkb red rj« rsc raow nym riyz a.i a.ay ape sb* aiym t-ay tiz ta taw taf Vlt vta vam wiyw yuwt 12 .huw -li .mow -tr .an -ayj ..f art d.a dlay dat duw. tmb erd ea. ea. gca idy ika IVi i/« lOa Jus ka. kwa kyuw kad kar kam Id. lea Un 11 11 10 10 10 9 9 9 (cont.) (cont.) (conL) (cont.) (cont.) (cont.) (cont.) (conL) esb azi an? avi awda awnd ayla aym. aywa ey.b eydow eyr. eyar lyny lyaa tywe uw.a uwma ?biy ?it izb Jin lis Jal ker kit kbi kas liyw m.a mar myuw mal mad muwv n.b nhay nnay noway nsow nte ntiy nz. nal nah nayg nayw n?. owra owsa owyuw owba paa qkl IJZ. r.d r.s r.a r.ay rba nk rim ns rtuw nya nyt slay stuw sayd siy. t.a tit ter tbey tap teyt vsa Wll Jur yuwj zka zal ada al. an. an. Oat aCv agu aks aid alt alw alb emw ama arj ase atb ave azz ad. adt akj anh anw any apa ask avb a?i awn. awnt awnb ayki ayts aywu ayan eyda iy.ay lyja tyka lyn lyra iyab uw.w uwka uwba mays meyj miy. n.h ndz ngow nsf n?t ow.h ownow owzd owbe owbey pra naw. niy. niya owka ptn piyr gar ra rdey nz riiy rmiy rsi rba nyh nyw ruw. s.b »-y sna 11 sow. -dy spiy .hi ste .te sag siy. truw aba b.. ts. ban tsi Cik tsr tuk dba duwb twi tal elay tbc ens ud. eja wai e?t ga? wayt howp wey. hawm z.h my zsa ie. zag i?. anb arn J'Yken biya mío a.h afow n.d n.t aja ns. aka alz nsay nt. alo nt amt nbi amiy anj nav 10 .dow .en .ha .ki .le .mi .pr .riy .way ar. bit d-y dray dba diyz eka enz ena erf erw fel flay gow. geym h.ay h.. hal hawd mi isa Q y .be .fr .ma .owy .se .si .al .af .ayt bad bayb biyi d.w dar dah diys duwy el. eli enj fií fown gen ifr inh inm lijl itw i?d Jak kse ksi kud kway keym l.w i-y lak Idi Iz. I0i lad lan med may. mayl zna zta zyuw zbey zav aka all aim art beyt beyv a.d a.n a.t aft 0-a ahm 0-ay alp OQa IJZ. ama amow qba r.h amb rtay amey apow rbey ara rag rayz ai« atey ray? awiy reyd nyd azg azt riyi riyp a?. s.w ama s.a apiy a?k sgay awdi sma sows aymz ssow aypi ay?. ssa eyn. sal siyn eya. tsa ly.s twiy lyduw tuwm lyn. vbi lyny wayl tyba yak uw.b yuwh uwda yuwz uwin yuwa. uwlay uwwiy z.a uwar z.a ?.i zda zja ?-y zlay ?.a ?ma o 0 .bay .fi -fli .ka .ne .naw .nay .owh .sm .say .ve .wu .Oi -0r -P biz bliy buk d.b dra dza dbe daw days dey. deyn diya ed. enw enay es. ess ez. ea. far ged hat haz haws ifb tie 10* IQS ISS ISW izk iba Jiyk.a eoi T A B L E S OF TRIPHONES 8 8 8 7 7 7 7 (coot) (COOL) (cont) (coot) (cont.) (cont) (cont) kl» kba kab kav key/ I.I Ibi Ibty UJ lu Ita lyuw Iz. lap liyi mta mz. mz. man mayf nbiy nfa nowb nowm nor owEn ownt owny powz ps. Q-b Q-y rbi rduw «g rtia rkw rna rpr rs. rtty rob ral rad rtyn s.t aid sis sowb sriy sta st« awtb £ ? . sav sayn ayga fif ftiy ayin Vi tbt ful ayka ter ayma g tan ayn. gow6 tya ayba gayEygow hawk tay tan £yka tit tuww iym. im. ud. Eyme imi v.. ink iy.i vba inw ly.a iQb WIS lygu wu? lyld isg /ud lyyiy tsl Ays uwduw ivz /iyz uwg£ l?Z yol uwmiy Itk uwni }an yat yaw ?sw laz Tyuw kr£ yaO Z.l kt. i/ kt. zga .OWÒ kti Zlt zsow .pi ktuw .sk kwi ZV£ .w£y kbiy za. alow l.b .ad -ayr l.m blQ a.w lek beg adcy ab. Ila aki akt lowv akty are Iva bil Ian ale amh lat bj£ amo baf layz anf biys liVfl d.s liyp apapt dal liya d£n m.w ass m.y asay dwa atw m.b dal avs db£y m.a dag m.ay «I azr diyf mil azw diyn m pa azay £ls mtay a?k £ni mwa a?n £sd maò n.D ads £tS nar £ta ntr nik npiy ntt ntw ntay nOr nay6 n?n ow.b ow.m ow.n owba owif owna owtuw ow 6 a piO pia pia priy pta pba pas Oka r.b r.t rfr rfa rhay rip rks rkt rl£ rlz rmy rsk rum rzow rbiy raj raet riyn ruwv r?a sdì sha sir) sit spi stay swiy sa. sat saw8 t.s tfa tr£ tsb tsk tsm tsow tsb tba tal tiyv v£n vab vas wak war wet ya£ z.f zba zfa Zl? zown Zt£ ztuw zb£ zba zat zaw za? ann azb 8a? b£ys b£ye a.b a.f a.m abl ei. ada ads ehaw eka als amz asd ath avb 6 6 6 6 (cont) (COOL) (cont) (cont) EZl Eòa E?aw fray fayv gin gowd gny gwa gayz h.y h.6 hway ham han hawz huwt ift iga ill inb in£ ita i?k !-• mayb rsiy mtyd rva n.f ran n.l raf rak nbi rayi ndft ndaw n y g nyr nis nil riyy nmow s.s nmay sda nmiy scp nni scv ntfy sil nza si? nawt ski nay. skay nayd Sil sowy niyd niyp spr niyv ssiy ow.f sts OW.S syuw OW.t aas owmay sat ownO s«yowrt s£yi ow/a s£ym owy£ siyb owya aiyay owal t.t owan t h a owap thy play tma pruw trfy tsiy piyt tar Ok. Olay tayd r£k tuwy rei udb r£z udì rga uki rga v.a na vha H. vnf rid vri ria vwa vyuw rne rnaw va. rowf vap rpl van wown rsay 6 .ar azb .baw azm .da .£8 abiy a?l -fay e?m -flOW -gr •?y .how adò a]uw .h£y .{ow anf .la as. av. .my avs -pa .piy ay.y ayf. .a aygow -tey a y k a -WD aymi .ad ayn. .af .ak aynt aysiy -ap -ev ayt. ayvi .az ayvw .a? ayat ..? a.b ay?. arm £y.w £y.a ata £ykò a?s £ynay baya £yt. bcyz £yta biyg C£n ty.b lydow Cirj iym £wa Can lyiz lymz d.b lyma d.i dar typa lyta dbiy iyz. diz lyab dsa lyam dta uwgow d v a uwsa dz. uwyuw dz. ?.n dak daym ?da dayw ?ha ?in diyb ?lay diyl ?pr £ll £pt I- Jik Jowr kil klow kowk ksd ksay ku? ka. kal kawn l.a lat Id. l£V May lai I6i lab lay. l£y. Ifyd m.m mag mal m 6a wu] way. wiyg w»yj wiyz JEym /iyw y£s yur y» ya» yuwb yuwfl z.n zba zfr zid zya zal za? akt al. air am an aray e.. bay bcyl a.£ a.l eb£y afiuw adv adw ada af! afay aga aga aga ah. akow akr akaw ely ala alEy amk am m anuw ap. 002 ADULT 6 (coot) 6 (coot) •pc •pu •IT arv arj Mb aap MW 9tk •vt •vy •wty lytn lyfa lyfay tyke 5 (coot) -aya a.a a.ay ab. aje iyiay lyni am lyown ant tysi ar. arb iyviy lywo arg arn lyas uw.s arv u w d o w arz •Jty azf UWlt at. •zk uwni atb uwn a?. aba •?b uwtEy a7t uw6i bla •?P aks uwal bra akt uwam brfy uwep bab an} bak «• ?.s a?m ?.a beys ?IZ biy. awka awne biyf ?ka ?liy awt. biyt ?m£ awar biyw aydl ?sk biyb aydn Cav ?S3 ?siy e*1 ayda Cuw. ayfa ?tay ayhs ?w£ d.t ayms daj ?ap aynE ?at dak ?awt ayst dfa aytu dja «j ayva dmiy -bl aywi dpr ayz. dva -fl£ -flU don ayza ayba .ga da. ay?b -ka dayd Cyduw .la dayv .mt daye «ynj cypu .na dcy. cyst .nEy dtyt .oway diyw eysa cyzb duww •P tdw ly.f Ju ly.h -tow tie tybi .as tip lyii .at Ela 5 (coot) Cmo Enm £rt Erb 5 (coot) kts l.f l.h Idr let t»g If. ct. Etb Ii? E?s Ika Imay fra Isa fny l&ty fak fayw laf g o w b lak laz gowz laq h.s h.w layd layv har liyh h£l liyl hil liyr hwc liyt ha. liye hah haw luwz man ha? mba hawl hawov mgo mmay hayt hiyk mal huww mal i6w mayg maym ids m£yn ikt il. miya n.m il. ndiy lib n£l ild n£s ilv niz ily imc nil nki ima inr nma nowt iog nowy iqm IQW npa izp nsc nw£y izr n6ow Jtn nay? Juwn niyb kluw niys niyy ksm owdi ksy 5 (coot) 5 (coot) 5 (coot.) Owf£ owki owks owls own. owpl owr. owwiy owz. owz. owza rsw rti rts rzs raz wiy. wiyn wiyv r£yj ruwo r?m s.d s.f s£a OW&l s d £ y o w a b s£r o w a y w sliy sma P£J smiy pfa sowh Pik soww powr prow sow/ pwi spow par sst svt pawn puwl SWE Oil sad Okay saf sak QOi siyt qsa Qwa siyi qzI t.h QZ& tap q6£ tbs Qan tiv r.m tsf tve f-P r.D tyuw ra& ta? rbl tac rd. tayl uk. rdz rf. uka u?n rfi rfiy vdi rgr vda rhiy vfe VI? nl v&iy nt rko waw wayd rlay rn. waya wty. rnd wcyn rowd rsd wcya JiO yir yao yuwp yuwv z.d zowl ZOW3 ZZI zan Z&l zap odi of. Dki old olg all Dls sly DID and 3Q. DSt azay Ogr 6Em bow. bat baow bae b£yn btys biyow biyay biyty a.a abc abr aba a£. ado agay ahay •la all akiy alb aie 5 (COOL) alh alk all amf ont anaw aown asg asm asa as? ata avf avg avk awf azh azv aOr abi a?d 8?t a?ay cdt adv an. aps ara asp asw asb atb a?a a ? ay aw.b awla awma awowl awwa awzi aw?s ay.h ay.t ay.b aydiy ayk. ayku aykay aymt aymEy ayny aysi 5 (com.) 5 (cont) 4 (coot) aysa aytuw ayv. aywa ayyuw ayzt ayar Eyba ?sn ?wiy ?ya ?al ?6i ?biy ?a. ?ad ?ar fiiyp d.m d.a d£S dgow dha dja dliy dn£ dnaw dowv dra dsk dsow dsp dtuw da? dad dEyl d£yv diy£ diyi diyp diyb duwE duws Ediy tyg» tykEyka tykiy Ey l a y Eymb Eyn. Eynd £ynz Eyts ly.y lyfa lyga tygow lyif lyla lynl lynow lypl lypiy lyrdlyray lysiy lytE lytay lytuw lyvi lywi lyye lyzf lyat uw.y uwdi uwEn uwEv uwjo uwny uwte UWWE uwzd uwat ?.h ?la ?s. 4A -dr .day .d£y .diy .Ek .El .fa -ga -la .Ju .liy .ma .oww .re .sa .wa .aw .ab .aya -?e a-y ag aka aniy ary asa at. a?l bad bar b£g b£v bli bowt bri bat bEyb biyh Cil Cab Can tgi tgv Eke Eln slow Elz Enf EnO Erb Ern Esf Esa f.b f£r fik fil fio fan gowa gow» graw gyuw gal gas ga; 803 T A B L E S OF T R I P H O N E S 4 4 4 4 4 4 4 4 4 4 4 3 (coni) (conL) (conL) (conL) (conL) (conL) (conL) (conL) (cont.) (conL) (conL) (conL) maya mayd mayk mayn mays n-g n-J n.r nbr nil nie nd. ndr ndy nda nfi nhaw nk£ nka nla nla nmi nowk npa nsk nsp nsa ntf ntow nta nwE nway nji na) naw nay na6 nap nawa nayh nayi nayk nayv n£y. n£y. niyi niyf niyh niyk niym niyn niyr niyt rt. niyz rtiy nuws rv£ n?f rwi n?h rju n?& rzi rih n?e owduw raem OWl? ray. owkE rayn owlb nyf owb riya owlay s-g owmc s.m ownr s.o owrj sbi owrs sbiy owry sdow owrft sda owsy sfa owzb sgow pwzk s f l r owar skow per ska pray sia smow ps. pat sma pan sna sniy ptyp sowf Qfa om sowl qwi spi qav spa ijew stow r.f sway r.k sya r.l syiy ran SÒ£ rb. sah rdy sad siyr rej rfow siyz rgow t.f rie t.m t.ow n? rk. tda rkl t£d mow tfr rny thay row. thiy rs. tja rss tka aft afu afa agi aha aha ahiy ahuw a]uw aky aim apa ari arow er? ash esl esaw etb ety etuw avd evh •vl evm evw ewa eyiy aza e&£ eeò a?a a£e afe ali ak. aka aqg an ass atk avr aje a?g a?l a?p awmc awn. awrz awtw awte awze aw?y ay.i ay.l ay.m ay.s aydr ayf. ayga ay in ayk£ ayld ayniy aype aypa ayn aysa aytE ayti ayvb ayzd £y.a £ydi £ydò £yga £yiO £yka £ym. £ymt Eymz £ynow lymay lymEy iynò lypr iyrò lysk lysm lysow lysay lytty lywiy lyzk lyzt lyzw iyzò lyziy lyal lyan lyep lyatk lyayl lyEyb uw.d ?&l ?eh ?aym o ys i ath atn atw a?ow a?e b.a bif bis bray byuw bz. bz. bav bayz biym biyn btyEy buw. i.ay iiz tal tez 6ayl iuwey d.h d.k d.n d.a dEv div dmi dowj dowp dpe dr£y ds£y dsiy dw£ dwa dzw d&i d&iy deft dawt daw? day. dayh dayi d£yd d£yz diyg diyh Jayn k.i k.t k.& kla kra ksw ktl kya kad kan k&e ka. I.d l.n Idow Un IE? If. Ifr Igu Igcy lha lit Imow Irruy Iray Iny Isow Iza la. lor la. lag laep layi layt liyb liyf IDl liym i2a i9m liyn luwd i0y 1er m.b i?h m.s mga i?i mha i?l miz i?n mm. I®mpl lag ]eh mz& Juwh m&E Juwcy mab ha h.a hm. hed has haw. hawt hiyd hiyt id. idc id& ifa ifa 10i]uw iky imp ima ini ind ing maw iniy ipt iqh 10? is. isn isay itb itr ivd ivy izf izm izow izy tlay tnaw tsd tsg tss tsy tan tai tayz tiyfl tiya tuwh tuwi tuwfy udì udì uduw uje uk. uks ukò un u?b zdt zha zhiy ziz zia zki zka zma zniy zpiy zst zw £ zwiy zza zza zayg obi aba af. afi afa ali alf V.Ò alk V£V ar6 any vga vha at. vka avò vtr az. viy. a?s ion viy. wad Oit we] Oi? wayn Oyuw wayay Oar w£yt ft£yj wiyf ò£yp wiyl ftiya wiyr a.k Jar a.ow Jar aar Jiyk abow abu yeaba yei y£ay abay aim yab yam a£a yap atiy z.ow ad£ z.t adow z.a e£s zdi af. UW.l uw.t uwbi uwha uwli uwma uwnay uwpl typ« £yr. uwr. £ys. uwwa £ytb uwye Eyvd uwe. £yye uwak tyze uwe? £yal ?be ?duw ly.d ?En iy-i ?fi ly.t lydiy ?hiy ?i? lyfl lyfl ?ka ?ki lygi lyga ?ka lyhaw ?la ?m£y IV»? ?n£ lylg lylow ?naw lyls ?pa iym£ ? W l ji .ah .al .am .br .ba .bay -tl .daw .fow .fiy -flay .ha -H .ka -kr .lu .owd .owr -pty .tow .ta -Ji .za .af -ey .ak .awt .ayb .ayi -ayp .iyv -iy& .?i .JZ ..aw ..iy a.b a.h a.i adiy ah. amiy aps arp ars 604 ADULT 3 3 (com.) (cont) (corn.) (cont) diyk hit i?m duway i?6 C.. hmm howm ]an ca6 han I " caa ha. UP cba haww ed. hey. lac (day hiya Jat cgn huw. Juwd Ckr huwz Juwe tie iti Joyd lowk lows Ipr Ipa Isk Iscy It Itf Iwu Iwcy laf las I6C l6ow I6iy la? laym layw icyg liyk liyz m.g m.J mda mel mcr mfr mgow mik mow/ mp. mpr mpa mpiy mat mtfy mtuw mza man map mav ma/ mar mat maB mayh mcyd n.c n./ nba nbay nCuw owl. nda nday owliy nfa owm. ngr owmi nhow owma nig ownt niv ownw njuw owniy nkl owp. nkiy owp. nma owpa owr. nna nowe owrd nowh owrp nown owwc nows owayh nowz p.a npr p.a nri pit pli ntg nta ptnwa pt pul n/a puj nyiy nzd pyuw par naf nfls per na. pa? pcy. naq na/ Q-h naz 0-i na? o.t 0-w nal nawr 0-a naw6 0-a niya ogw niy? oga Qkh n?b n?w qka n?a Osow nayz Q t U W ow.k Oyuw ow.p Ozt ow.r 06a ow.a 06cy owba oaowba oab owd. r j owda r.n owhow r.ow owhaw r.iy owhiy rbiy 3 Civ i£uw k.a £tw if. k.a eley ifi kia cm. igr kCa cnf ika kda era ikuw khiy «'I CM ilz kik imm klay cap inp kliy ct inv kmay Cza inz kow. caa inO kowl C?6 may kowv e?a in? kpl f.b IOC ka f-y f.a iQn kro iqp igr kra f.JB fay krey ksa fa6 iQV IQ3 kwc fla irz kftcy fluw ira kah fut ISC kaya f6a l.a fftty »»I ism fam lay l-P 1.8 faa ita la? fav itf icr faa Hi gad itl itow gc6 itiy IflOW git IV. lhaw gna izb lif OV» izs lit 0«V gayft ut uz U* Ikow g«yt 10k lie h.g i M lis h.k 16» Iky h.a tan Ina hap Ifa low. 3 3 (cont.) (cont.) (cont.) (cont) (cont) (corn.) rCi sba tsl rds sba tsp rfa sdiy tscy scs ttuw rgy sc? twu rho sgcy tway rja rjw shw t&i /•- SlC ta. /ip rk. sk. taa /OWl rtf ski tab rla sky tayn rm. skiy tcyn rm£ sla rmi sla tcyp tcy? rma smc toys rmay smay tiyw m. snay tuwc rni sowc tuwk rncy sowk tuws rniy sowa udf row. spa udn rowk uds rown spiv sray /az Jiyey yeb yaf yaj yav yuwi yuw/ yuw& z.b z-g i-J z.k udy Z.I rp* ••a uda rpuw stb ukl rn stw uie rsp ste um. rt. sya ur. rtw sOi v.k oje aks any an? arf arl ar? ati at6 atay ava awty Osiy 86a 6awz Bow. 68] 6av 6a/ 6ad 6an 6eya 6eym 6eyiy 6iye 6iya a.J e.p a.r amaw amay amuw rgc we. wa/ wayiy weyz wcyb /-a rwc saa v.n rwu sa? v.ay ryiy sawn vbiy ran saya vdcy rzz scyy V£l rza scyb vid rap siyw vis raft suwp vmay rab t.d vz. raf vol rav t-g t.k raym t.l vbi rcyl t.e va? rcyz t.? vawt rcy? tba vayd nyk tdi viyr ruw6 tcm war s.c tcv wed s.h tis wet S.I ti? WCW s.n tka we/ s.r tpr WlJ s.v tsh wtr vfli z.p zba zdaw zfa zga zhay Zlf zik zkl zmow zmay zmiy znay zowv zpa zri ztr zta zya zad zam zas zaz zayw zayO ziy. a.. a£t a£a 9.8 ab. ebz ebuw oit adf adg adh adl adn adp af. afc afiy aga ajakt akw alf alu alv ale amd 3 a 3 (cotlL) 3 • 3 (COOL) apf aps apw aok arty asow as6 atd atm av. ave avcy a/. a/a a/aw azd azl az/ azy aar a6ey aav e?h a?i a?I a?/ abl ady ada ak. ak6 all alk ami ana amy ape aok any as. atm atw atay ave avh avk avn aar TABLES OF TRIPHONES 605 3 3 3 3 2 2 2 2 2 2 2 2 (corn.) (coni.) (cont.) (cont.) (cont.) (coni.) (cont.) (coni.) (cont.) (cont.) (cont.) (cont.) JB?b ayzw lyvE ?miy .row bEl dowC Era g o w o w iki Jiyk Ida a?d ayz6 iyvò ?ni .sb bid dr£ gowp ikow Iiyt Idh mff £ ray ayol lywu ?nay -SW ble ds£ Esh gowfl ika Jiyw Ido a?h aya? lyway ?pl bowl dst ESk gn ile Jiye Iduw bowO dsay ES ò grò lEf dtiy CU gra iig ili Juw. bny Juwl Ifow ba. dur Eth gsp ils Joyi Ihiy bag dwa Etp gu? im. Joyò lib ban dwi Eviy gwi imow Joya iig a?y ayaed lyzi ?sp « y -9UW aw.a Ey.b lyzn ?sr -tiy awdy Ey.d lyzs ?ss awdò ty.h lyzo ?8t awnh ty.i lyflr ?tw .zow awni Ey.s iyò£ ?way .ayf ba? dw£y £W. gz in/ k.b Iti awnn £yar lyawt ?on .ayow baw£ dya EWE gol inEy k.d aws. £yit lyayd ?9r -ayy baw6 dzf EZW gan inuw k.f Up Ikl awti Eyli lytyr /Sow -aya biya dzh E?. gayb ip£ k.w Ikay awfls Eymd iy?. ?el -£yt biyb dzi E?l gayg ips k.o Hey awen Eyrh iy?8 ?ay. biyè dzm £?m gayi ipa k.ay Im« aw?. tyrp uw.k oynd -ivi -?ay awTt £ys£ UW.3 aw?w tysty uw.ò ..Ey biyp ay.w £ytu uwba .ab a.s biya ay.e £yto uwEd .88 abz biyay daa ay .a £yvg uwga -ba aba biyty dal fes h.n iry kEw lowz ayam Eyvi uwld .de agow bay. d a m fhiy h.t iriy kfa lowft ¿ .6 biyd dzt E?e gayw ipty kag ln£ biyl dog f.d h.b iqd kam Inow dov fa h.f lowl fbD h.h iQl iqa kan da] kb£y lowp fck h.l ir£ k£m lowr ayba Eywi uwlr .du dap fid h£d isb kif Ipi £yyuw uwlz .fa al» ak. boyf aybr boyz da/ fin hm. tsp kli aybiy EyòE uwrE .fi ak. e.t dayk fis hown isa kow. lp« lr£ Is. ayds Eyen uwro .fi aks aydz £y?t uwtr .fu alb ayduw ly.k uwvd ali aytn ly.m UWVE -fy .fx aliy êki diyay fna haz itò ksf Isw ayfiy u w v a w -go amp Cmow duwr fowk ha e it? ksow Isay ayhow IV-P ly.r UWWl a m amw Cta E.W fowl hat] ivo ksiy Itr ayhiy lyar uwyiy .Joy ama fiyuw ECa fri hawf ivay ktm Itiy ayi? ty6. uwòEy -k£ and eòa £db fra hawi U- ktw Ituw aykC lyfow uweb -kow an? 6ak Eds fòa hay. iji ktò Izr aykf lyha uwad .kay apr öas fek hayd i/k ktay Izó aykp lyho uwsv .k£y apa tob Edò Elh fat heyt i/t kuk lo. ayks lyji uw£y. .miy art Caz fai hiy. IZE kwa lok fam hiy. izg kom law fayd hiyn izh kot la? lam idi tir tu day» fit howr itd kowp diyd fia h or itk kows Is. diyo fka hav iti kray Isl ayl. lyk. uw£yt .muw as£ Ciyr £11 Elm aylb lyk. uwEyJ .ni ati ¿uwh El? ayli lyku ?.b -ny atr Cuwa £m£ fayE huw. izv kaw aylz lyka ?.k .no a tv d.d Emi fayk huwò izo kej lat aymw lykEy ?.t .nò ava d.l Enb faym ibz izay kap lays aynl iyilymi ?.e .ow. aji d-J Enö fayr lih iziy kaym laya aynn ?daw .owg azi dbi £n£ faya lòk i9w kiy. icyf ayrc lynn ?EV .owk aa. dba Enh feys i6a lòow kiy. lEyJ ay». lynz ?fa .owl aat dfo Enk fiyt lòay i?P kuwb lEyy ayvE lyowl ?Q£ .owm a?p dhaw Enr i?a kuwa liyè iyp6 ?9r -OWV b.i dhiy £r£ fl-6 gav id. ayvh idk Ja- liyy ayvn l-J lyrs ?gay -pi b.k dka già ido Jriy Ibi liyo ayvt lytow ?ko -pu ban dm£ £rfl Erk l£i liyò bas dna Ers Jwa ICa Ity? bdiy dnow Ero •gf U- Jur -py .pa gli gowE gowl ik. Jye lioy luwm ay/u lytw ?l£ ayz. lytiy ?may 606 A D U L T 2 2 2 2 2 2 2 2 • 2 2 2 2 (com.) (cont.) (com.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) luwt miyh nsaw owha PS£ rbae raya sob tiyr vzm Vt? afk luwe miym ntd owhae pt£ rb£y r£ys sa? tiyy vzy yul agz lay» miyt nth owjo ptl rbay r£ye sayt ttyft vze yar ah. m.l m u w n ntk owjuw pts rd£ riy£ s£y. tuwd vflr yea akd m.n n.a ntm owkl pt& rdf riy/ s£yd tuwl vft£y yaa alt m.ow n.C ntn owlm ptuw rdm riyiy s£yj tuwr vag yaa alae m.t n.k nty owlw pu? rdp riy? s£ya tuwO vah ye? amm mbi n.p ntft owie pan rdr ruwi siys tuway vat yuw£ amy mbow n.e nv£ owla p6£y rdw ruwr styv tuwiy vav yuwf ana mbiy n.? nva ownf pak r£t r?. siy£y tuw? vaO yuw? anf mdaw na. ny£ ownh pam rfb r?t suwn udm w.y z.z anm mck nad nyow ownk pav rfu s-l s?s udt w a i zbi ans mg£ nak nzb o w n m p a d rgay s.k t-J udaw wad zbay anw mhow nap nzi ownp paek rhi s.aw t.r ujuw wak zbiy apt pel mhiy n b c nzw ownft rhaw sar tfay ul. wal zdr an- mid nfi. nza o w o w v p£ys rib sb£ tg£ ulk waj z£n aqd mit ndty nzay owpn piyd riC sbl tg£y uma W£& z£r aqw mi/ n£m nop ó w p w piyn riv sbae tha ur. win z£v aqa mki nfa nOg owpe piys rift sdr tki url WlJ zfiy arg mka nf£ nOa owrl puwp rkae sdaw tkl urw wah arj mkay nfae naed OWtl payn rm£y s£m tkay urft warn Z01 zgow mla nfay nasf owway rnh S£t tmae us. waa zis a row mliy ngi nsn owzt Q.k rowb sgu tmay usb way. zkr arw mmt nga naes owzh 0-1 rowg show tmoy usd wayow mmae nh£ naet owzp Q-P rowl sha tnow usk mowk nha nae? owzs qba rowv sir towr mp. nhuw naway owzt Qbae rowe SIÍ mny nid naw? owzy Oil rpae msow nim naya owz£y qfiy mtr nj. nay« owan mta n]u n£yd mv£ nka mw£ nka q.d ark zkw arae ways zm£ atw ust way& zna ate towv utb w£yk zn£ avi sja tow? uf. w£yv znow azi rpiy sjay tsv U?. w£yy zpr azy ogi rsaw skm tsaw V.l wiyt zpae aza owOr ijhiy rs£y skr tsay v.m wiya zsi a?t n£yp owa. Qi? rtm skw tud var wiy? zsw a?6 n£ys owel ijja rvty slu ty£ VII fto zt£y e.s mwi nkae n£yw owayd ijkJ rwiy sm£y tat vli It r ZWl ehiy mwiy nlu n£ya owayl Qla rzj sowg tav via I ik zjow 6im 6ki mzi nluw n£yO owaym ijnruy rzt sowi tei vlay M z/iy mzl nm£y niya owayn QQ£ rzw sowr t&iy vliy Jkl zzay Omay mzt nnae niyay owayQ Oijay rod spa tai vma fow. zz£y 8ri mav nnaw nuwy p.s Qt£ rof spu taz voww Jowd zaf Orow mfiiy nowf n?i P-V qan raq sra taa vr£ /OWE zOi Bad mak nowl n?ae P-o Q«P ras SS£ taO vray Jt. zaf Bag mam nowp n?ay paz qas rat ssk tac VSl /e? zah Oam mat nowv ow.d P£k qat rtow ss£y taay vsk Jawa zek 698 maz npl ow.g pir r.a raw stk ta? vsm Jiy zayn Saw mawn npae ow.l pka r.r ray stt taek vta Jiyb zays 6in mawt nr£ OW.J pit ral ra? stu tawr vtay zayv be. zayz &a& may. nra OW-? pmay rar raq sty taya vtuw fiYfl Jiyh mayi nray owbay pni ras rmj stft t£yd vwa y.a z£yt 6eay mayp nrty owdaw ra? ra? swfy t£yh VWl ya- ziy. sty powl mayr nsn owfa powp rb£ rayf san t£yj vwa btyee nsw owfae pra rby rayg sat tiy. vy£ yíy£n ziyow mayt 3-8 6iyt mayy ns& owga prfy rbo rayh saj tiym vz. y£v a C. a.v T A B L E S OF TRIPHONES 607 2 2 2 2 2 2 2 2 2 1 (cont) (cont.) (coni.) (cont.) (coni.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) aba a?g awtuw ayvs £ytaw lynf uwbs -OWl .awd aday a?r awO. a y w o w Eytiy lyng uwfay ?-0 ?am oyer •bs .own .awn afi 1 1 1 (cont.) etf aebi awòa ay/ow fyvz lyns uwgo ?ba .owe .awr afm »ii aebr aw&ae ayye Eyva lynaw uwga ?bi ... -pow .awe afe eiw aebs awaz ayzk Eywa lyowz uwgay ?bl .aa .pae -ay£ ag. •Cy cd. aw?£ ayon £yw£ lyp. uwik ?baw .af .paw .ay& agb ade aedi awTf aya. £yziy lyp. UWl? ?iuw .as .puw .ayuw agf adm «dp aw?k ayem Eyor lypaw uwkE ?dt .aae .ra .ay? agr e£n aediy ay.b ayav £yeg lyrf uwkl ?d£y .a? .r£ agw afk cf. ay.g ayaym £yòa lyrm uwku ?fo .bo .ru -ty.Eyb •fy agi aeky ay.k ayiy. £yò£y lyry uwkw ?go .Cow .£yd ah. aelf ay.n ay?b £yas lysp uwlò ?how .rae .£ym ai? ags aeml ayd. ay?m Eyaes lysuw uwlae ?k£ to -ro aki eng ayd. ay?n £yiyv lyt. uwm£ ?kl .Cay -r£y .sa .£yn agw _£yr akn iae age agz enm aydy ay?t £y?w lyta uwmow?ku .Ciy .sd -£ya akr •gty ahi aenp aydfy £y?6 lytr uwmz ?la .do -Sf ay. akj aenj ayfr £y-9 £y.m iy-£ lyts uwniy ?mo -£h .SU -tyè akay ail aesfi ayfz ty.p ly.n lyta uwpt ?nd -ti -lyg al. ai? aesh ayfaw ly.ow lyvs uwsf ?now el« alg aesi a yi m iy-V tyd. -£J .EU lyjiy uwsk ?na -fn -ue -?a aesi ayit £yd. iy-J iy.£y lyyi uwst ?own .faw .va .?b aln aesn ayju £ydy lybr lyyuw uwt. ?pow -fuw .wh ams aes? aykb Eydz lybo lyzb uwt. ?rae .?k amg aetf aykh tydiy lybay tyzd .wow .?l ami api aeth aykm tyfe lyd. lyzh uwts uwv. ?«. -wn amy -gl -gw ?S£ -h£ .waw .?s ams epm aeti aykw £ygr lydr lyzow uwvl ?sf .hu .Jow .?t amt apaw arty ayky £yhiy lydy lyzp uwva ?sh -hay -Jr .?ae an£ aQw «to aykcy lyzr uwviy ?sl -ifl anh ayl. iy£l lyzv uwwu ?SOW -oy£ ann etf aezi aylh £ykt iy£t UWW3 ?sv .yow ..u ans atl aezt ayll £ykw iyf£ ivo lyOo -10 .is -y.ya .?aw aev8 tyjtyk. lydz ass uw/u ?say aw .yu ..V anv atn ae6i aymh iyliy lyfi lyOaw uwyo ?s£y .yaw ..e ate aeet aymft £ymf iyg£ iyòow uwz. ?t£ -It -Jo aviy ae?n aymay £ymi iyg£y lyef uwzg ?t£y a.d api ae?r ayna £ymo lyhi lyag uwzi ?wu -Jiy _kl .zu awu .zw a.£ apt ej- ae?e ayni £yme lyhw lyak uwzy ?w£y .km .ob a.J efa aw.f aynp £ymuw lyha lyez uwza ?Jow .ku .oh a.l apy ai} e -tay .zm al£ ali alow alay -oy ap. ap. a/i aw.y ayny £yn£ lyhiy lye? uwol a.n an aw.ay aynz £yna lyki lyaev uw6£ ?/iy ?yu -kw a/ow -kiy .Dm a.ow arj ®Jt ajiy a w £ u w aynft £yp. lykl lyawd UW&l ?zt .la .ow a.ae ari awd. aynaw £yrf lykr tyayk uw&iy ?ov -lo .eo aah arw azow awdo a y o w m £yrg tykw lyaym uwag ?0k -ity -0e ab] arj azp awnC ayown £yrn lyll lyayv uwan ?en .Oaw abfy aro aze awnz ayra Eyrv lylt lyaye uwes ?aw -lay .mw abiy arò azi y awniy aysg Eyro lyly iy£yn uwa/ ?an .m» -®0 ai. ariy aCd asl aziy awra aysp £yny lyb lytyt uwayl ?ayv .maw -el .ae aa. SWS. aytow £ysb lyle uwayO oy.. .n. .ae. aèe asp aa. awsi ayv. £ysi iyl£y lyfyJ lyiyz UW?. oydi .ns .aef ad. asiy iy?. ?.d oyda .nae .aer adi atb ?.f oyfr .nuw -CS adm at£ oyit .noy .SB6 adow atj ays. -owb .aeae ado atl eaek awsa ayvd £ys6 lymd aayd awtm ayvl £yt£ lymow uw.J aayw awts ayvow £ytf lymt uw.n a?a awtiy ayvr £yti iyn£ uw.ay ?.m ADULT 608 1 1 1 1 1 (com.) (com) (com.) atp bsow att bso aty atay 1 1 1 (com.) (cont.) (cont.) (cont.) (cont.) CEl d.r Cfu d.v bsaw Cfo dag bsay eh« dbo atiy bul Chiy dbae atuw byu Cid dC£ avz bzo Cip dCay a6ae bze Ckl diiy a&Ey b3d Cko ddr £te £taw £tay £tuw £ul two £wiy £/e £Jm asi bos ei* dda asm bftt Clay dduw aeay b6e Cm£ d£f aaev bej Cmo d£i aayg bes CmEy d£r aiyi baw Smiy dfr £d£ £dh £dn £dr £do £dae ££l £fd £fn £ft £fe £g£ £gz £h. £haw a?. b c b 6naw dfay a?b baes Cowp dfiy a?f bae8 Cny dhuw a?g baee dil fne fnaw fnoy fowu fro fr£y fray fsu ft. ftf ftu ftay fud fun fwu fwiy fyu fz. fze fol f&£ f&ow fe. f«i fep few fe; fob faeb faeg fast fae? fawl fawm fawn fawo fay. fayg fayh fayp fays fay? fEym fiyb fiyd fiyi fiyr fiy? fuwd 9-d g.k ble boyd i u w m duy blow boyl Suwt dwu bio e.i Cuwz d/e blty t.m C?m djiy bna e-y Coys dy£ dzp dzr dzs dzo dz& dzc dzay dof dOi dOr dei deow dee dae¿ daef daen daer) daes daet dacv daw. dayb day£ dayg dayi dayl dayn dayr dayuw diyr d£yt d£y/ d£y& d£yaw d£yay d£y? diyow diyv diyy diyfl duwb duwg duwk duwn duwt duwv duw6 bnow e.& Coyz dyi £.1 brc e.e d.f dya» £.e brow Í.JB d-g dyiy £81 bra Car d.ow dzg braw ib£y d.p dzow £aay £Cf a?h baw. a?J bawi a?k bawn Ct£ its tte ttb a?m bayf Stay a?n bayh atiy dki a?w bayl Cur dkw a?6 baym Cwu dmae a?aw bayow two dn. b.l bays 6wEy dny b.t bay; Cye dniy b.6 bayy ¿29 dowy b.e bay? Ce. dpi b.ay b£y. bcyd baft b£yj to. tod to g dpu bab bbl biyj Cap drae b£j biyr Sawt driy bes biyz éayd dsi bib biyo CayJ dsl bih biyaw Ciyz dsn bim buwl Ciy& dtay dim dip dir die drow dro bi? buww Cuwd duy bji boy. tuwk dum £19 £1? fifi. £kp £k; eld Elt £lu £liy £md £mf £mp £mr £mt £me £m£y £miy £ng £no £nae £naw £pr £rl £rm £rp £rr £r? £sn £s£y £siy £S? £tb £tf £tm £tr EtV £Z. £zn £Zt £zy £z6 £ie £0e £&£y toy £ej £e& £e? Eaef £ayd cayr £ayv £ayw £?b £?£ £?h £?0 f.n f.t f.w fag fal fam fdi fdow fde fdiy f£d f £/ ffu ffl£ fko fke fli flow flae flaw flcy fmo 0-P 1 1 1 1 (cont.) (cont.) (cont.) (cont.) g.w ha? hh. him his how. howi howow hows ho w w howz hud hun he. hef hel heq hat haer haej hawb hawh hawj hawy hawe haw? hay. hayl hayn hayy hayo h£yl hiyf hiyg hiyh hiyi hiyj hiyl hiym hiyO huwb huwd huwh huwr huwe huwiy i.h i-; i.. ibl i be ibuw it. iCm lit idd idj idl idow idr idw id; ifa ifd ifh ifn ifow ifw ifl igh ifl' igp igs iflt igv igy igfy ihay ina inae inoy iowI a-ay g.£y gan gbae gfa gfi of» ghe flif gii gir gift gla glow glo glae gliy gowf gowh goww gpiy gruw g»t gtiy gv£ gyu gzgzp gzo gol gor got gad gaem gayC gaye g£yr gtyv g£yj g£ye giyr h.£ h.m h.p h.r h.; h.o h.£y hal has hat ilUi iIO ilP »Jr Ut ik. ikd ik£ ikf ikk ikn ikr ikw ik; ikz ikaw ilk ilm tie lift ilay ima imb imo imay imiy ipipb ipf ipi ipow ipiy iqa iqe iqaw ir. ird irg iri irn irr irs isd isf ish isr is; ISO is6 isiy is? ItE itg itm itn m itv ity itay IV. ivm ivn ivr ivw IV& iw¿ l/E l/f ijay izl IZW izae izEy iOd 609 TABLES O F T R I P H O N E S 1 (cont.) 1 1 1 1 1 1 (cont.) (cont.) (cont.) (cont) (cont.) (cont.) Jaep kla I 1 1 1 1 (cont.) (cont.) (cont.) (conL) (conL) Ivz m.k mwu naf now? neiy kmow Iga lwow m.p mwo nb£ npi naeé owbay Jaye kaeb kaefi Ifiy i8g (Oh Jíyl km« kaef m.J mway nbl npu nsh ow¿£ Jiyb kmiy Iwty m.a mwfy nbow nrow nxk owii i8s Jiyd kmuw kaek kae? IwO 10 n •ge Igr Iga maC mjuw nbu nru Jiy£ kn. n »/ owCe 106 kawp Igay l/i lyiy mal myg nC. nruw nez owd. i0ae Jiyh kna kawt Ihuw Izd mbd mzg ntt nsd naeae owdl lOaw Jiym kn£ kaw? lik mb£ mzow nCn nsh nawa owdr iBiy Jiyn knk kay. lil Izf Izh mbl mzay nér nsy nawn owd£y i&b kna kay. n£w nsa naww owfr kayd mb£y mag nCae ns£y naw/ ida Jiyaw kow£ kayh IJi IJiy l*J Izk mof knaw IJ£ mbu ifth IiVP Jiyz Izs md. mam ndb nta nay. owfa i6aw Juwk kowd kayk IJuw Izy mdp mae ndd ntb nayf owfl iftiy Juwr koww kfyd Ikt mdiy mOr nd£ ntl nayj owfy Jay. kowz k£ys Izay mduw m&i ndf ntu nayl owfiy 18l Jay£ kowe kiyg Ikm IkD Iza 18. lav m£t me. ndm nva naym owgi kp£ kiyi Ikiy laa m£v med ndt nvay nayz owgr krow kiys lia leh m£8 mef ndw nviy naya owgu n£yg owgay i6£ las jDym I9t Joys lee k.a kriy kiyv lli leí mfa meh ndc nwa te? k.£ ksa l.k Mu le/ mf£ mej n£t n/ow i?b k.h ksb l.ow Ib lay mfi me0 n£? n/ay i?f k.l l.t lluw laa mfl maes nfl ny. i?r k.y ksg ksk kaa ksl l-J 1.3 Ixd i?/ i?V l?3 kbí ksa i.e kbae kse l.£y l?0 kbiy ks6 I-b kiuw lay ks? J-J kdi J-P J.s Jas n£yh owi. OW£S owh. n£yj owh. n£yk owha owhay Imo Ima lm£y mfa maee nfow nyi ncyl laf mfiy m»? nfiy nyl ncyr Isk mgu mawd ng. nzí n£yv Imuw laer mhx mayw ngw nzg n£ya OWit OWIZ Iniy lav mhaw mayO nge nzh niy£ owfi lab low. laz mim maye ngay nzk myi owk. kt£ la] lowd lawd mir maye ng£y nzl niyft owkw kdow ktf lar loww lawt mkl may? nhi nzm my£y owkc k£. kth las Ip. lawa mlay m£yg nit nzn nuw. owk£y k£p ktow lav Ipa layh mm. m£yt nif nzow nuw. owl. Ibae Ipf layl mmi m£yz nir nzt nuwb owla Ib£ k£t kti] Jdi owhuw k£v ktj ld£ Ip6 laya mmow m£y? ni/ nzv nuww owlg Jde k£? kty Idm Ipcy layft mmo miyf nie nz& nuwz owli J£f kf£ kta Ids Ipiy l£y. mm£y miyk nj. nziy nuwe owlj kfi ktaw Idy Iras l£yi mne miyl njd nzuw n?C owlk J0«V kfa kue Idz Ish l£ym mniy miyr nj£y nad n?d owll JiQ Jowk kflr kga kw£y Id6 Ism l£yt mowm miys nkow nag n?l owlow k/i Iday Isp l£yv mown miyv nkr nah n?p owlr ld£y Iss l£yS mp£ miyy nkw nak Itye mpi miy& nl£ nav "?/ owly Ist Jív J0W8 khi kyu Jpiy khae kzow ice khay kzp Isa liyj mpk miyaw nle naw nayi owma JW8 khuw kza l£0 Isiy liyow mpow miyay nm£ nO. nayl owmz Jar kirn kOr ItJ l£m Iti liyae mps miy? nma nOow ow.C owmiy Je. kts kftow l£í Its l?p muwz nna n6p lab kiz kefi IfE Itay mp£y m?e nnay n6r Jei keg Ifg Itey ms£ n.ow nowfi Jem kl» kjuw Ifh Iv. mse n.aw Jep kkow l?t l?w m.£ mpt kak Ifl Iv. m.f msc n.£y lew kkr ka& Ifs Ivd m.h ms£y n.iy kl£ kaa Ifaw lv£ mtiy na. I«v lo? ke| m.i n?0 OW.£ owl6 ownb ow.v ownd n&a ow.a ownt nowd naa owar owns nowj neC owbt owny nowr ne£ owba ownz now/ ne£y owbcy ownaw ADULT 610 1 (cont.) 1 (cont.) 1 (cont.) 1 (cont.) 1 (cont.) 1 1 1 (cont.) (cont.) (com.) I (cont ) 1 (corn.) 1 (cont.) I (cont ) owowl owpa owpi owpm owpy owpa owpft owpay owpay owrb own owrm owrw owrO owray ows. owsk owsn owsp OWS& owsae owsay owsiy owt. owtf owts owtj owtO owt6 owuf owur owvb OWWl owjy OW/3 ow/iy owza owzf owzt owzj owzl owzw OWZD owzO owziy owo. owow owe. owOa ow6z owed oweh owem owet owes owawd oway. oway. owaye owayg oway] owayk oways owayt oway/ OW?. ow?b OW?l P-b P-l p.n P-P P-t p.w p.e P-6 p.ay pak pal pan pan pas pat pbi pbay pCi pcd Ptl pfae phay pié pid pig pliy pme pmay pna powd powk powv psh ps6 pta ptae put pwa pya pza pad pom p&ae p&iy peb pad peg pap pez pes pe& part pae? pawd payp pEyd ptyi p£yr pEyw p£yy ptye piy. piyb piyC piyi piyl piya piy6 piye piyae 0-a 0-6 Q£d t]£n Oír QfOW Ofr ogtv Oha Qhi Old Oif Oik QIS Qlt Ole rjk£ rjkm qkw Oky QkO Oil Qmi Omow Ome Qmay 0n£ qnt On£y OPi OP® Qpuw 003 OQaw qrow r)ru gray oriy OS. ijtay ijwty Oye Qzh QZW QZZ qze QOf QOl QOI 06iy Oed Qeh oek Oel qem Oej 00? 0«f 0« Oawt oaw? qayw oaye qay? 0?o?i 0?s 0?» r.£ r-I r,? ra. rad rag rap rb. rba rbb rbd rbr rbaw rbay rC£ riae riiy rda rde rdj rdk rdl rdu rd6 rdaw rday r£C r£j r£v rf. rfl rft rfay rga rgi rgi rh£ rhow rhw rhuw rif rju rjay rjiy rka rkb rkh rkn rkow rkr rku rkft rl. rli rll rlu rlw rloy rm. rmm rmt rmz rmo rmuw rnl rns rnt rno rn8 rn& may rowt rowm rowp rowt rprp£ rps rpu rps rp£y rr£ rrow rru rre rray rny rso rsO rs6 riyv ny£y ruw. ruw£ ruwf ruwk ruwp ruwa ruwO r?i r?l r?n r?s r?iy rayd s.C s.p s-J s.e s.? saf sab sa? sbr sby sbay séiy sdy s£6 sfa sfi sfr sfu sfae sfay sfiy sga sg£ sgi sge sgiy shi sha shaw sig siv Sl& sj£ sju sk£ skh sku skae sk£y sl£y sluw smuw snow sns snaw sn£y sowb sowd sowz SOWD sowaw spaw sri sru sr£y SSI ssay std sth stj stl stp suf sum sup sur swa swr swu swa sjow s/u syu saf sag sat sam soft set sOa sOaw s6i s&£y s6iy sew se6 saeb saef saez sawe saw? say. sayb sayg sayh sayj says sayz say? s£yf s£yl s£yn s£yr s£ys s£yv s£yw s£y? siyb siyg siyk siyo siyt siyo stye siyaw siyiy SllWt S?. s?g s?k s?l s?m s?p s?y s?e s?e t.e t-P t-V t-; tak tan tb£ tbu tbay tb£y tbiy tbay tdiy t£é t£k tía tfa tfl tfow tfa tgow tgu thi thow tha thaw ttf tip tir tij tj£ tk£ tkow tkr tku tkw tkaw tkEy tl£ tli tlae tlaw tm£ tmow tm£y tmiy tmuw tna tn£ tniy towa towb towj town towp towt tpi tpl tpae tpiy tq& tra tru tsE tse tsae tsuw tt£ tte ttiy turn tuj tws two tw£y t/a tie t/iy tyi tyiy taf teiy t&ow tea tej teow teq ta/ taet t*J tae? tawd tawn tawt tayg tayh tays tayw Uy. tEyf tEyJ tEyl tEyr tiy. tiyd tiyl tiyp tiyz tuwb tuwf tuwg tuwn tuwow tuwt tuwz t?t t?e uda udp (].£ o-f Q-fl Q.m Q.n Q.r Q.S 0-? qar Qbi i)bl Qbo qdi qdow Qdy Qde rsae rs? rtl rtr rto rvi rvl rwa rwr rwa rway rw£y r/a rfi rje ry£ rzd rz£ rzf rzg rzy rzft ro. rag rot rap r®. red reh rer res rta rea r&i re. rei re/ raed raeg raek raep raes rae& rawr rayl rays rayw rayae rfyi rtye riyi riyow 611 T A B L E S OF T R I P H O N E S 1 I 1 1 (com.) (cont.) (cont.) (cont.) udw u?f vpiy w£h udj U?l vra wEl udz u?k vrae w£m udD u?m vr£y ude u?s uday I (cont.) 1 1 1 I 1 1 I (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) A? Z.t zn. z£y. OQS edi &Z. af£y Jma z.£y zn£y z£y. OQt Odiy &3l ag. Jowm znuw z£ym oijy 9£d 6or ah£ wis zar Jowv zba zowk z£yv orb 8Ev &o? ahh vsn WE 9 Jowz zbr zoww ZEVi or£ Ofa bai ahu u?6 vst W£? /owe zb£y zowy z£y? orv Oha 690 ahw udiy v.£ vsae w h u w zpi ory Oir 699 aig vsay wia zpl ziyk orz Okr 6eae aim ufiy v.h vsiy wny /to zpu ziyn oro Okw 6ae. ain ukb V.I vt. w o w k /tuw zta Ztl ztx ziyg v.f In It r zboy uft zp£y ziys or® 9mt &ae£ ej. ukd v.p vt£y w n Ju? zd. zra ziyv or£y 8miy &aei ejb ukow v.t vtiy wry /wa zd. zr£ ziyO OS. Oniy 6aem a{ow ukw v.w vwiy wray /yo zda zru zuwo 0S& 9owl &C0 air ukae v.y vzl ws£ /ol zdO zra o.m OSX Opr 5awt ejy ukaw v.aw vzow wo? /on zdfy zsa o.n otm Or£ 6£yb akn ukiy vbr vz& wa. /a. zdty ZSE D.ae otow 9s. &Eyf 8k/ ul. vbae vof w a g /as zduw zs£y ob] ots Osi ft£y / akz ull vbcy von wai /av z£J zsuw o£b oty est 6iyg akay uln vd. vor was /aen z£k Ztl oCf ovs esa &iyk vd£ vow way /aww zfa ztow otb all ulp ovt Osay 6tyl alow uls vdh v6£ waay /ayd zf£ ztw odw ov? eta 6iyw el/ ulo vdow v&f w a u w /ayn zfl ztaw oday owr etty 6tyaw aluw amn ula vdr v&ow waw. /iyd zfx zus od£y owa Owe ftiyiy umb vdaw veC wayt /iyi zf£y zva oduw ozh Oway a.e amr umm vfo vad wayr /IVJ zg£ zviy of£ ozs e/iy 8-0 amoy umz vg£ vaf wayy Jiyi zgr zwa og. oz/ Oya 8 / anv umft vgow va] wayz /iyn zgu zwow oga ozz Oor a.z anoy umiy vgr vek wayo /iye zh£ zway ogr ozo eea a.ty aowh unt vgo vaz w£yd Juwr zhi zw£y oga oOo 0 6 « a.? aowp une vga va& w£yf yam zhow z/u oim o&a 99. ab. apb upe vhaw vaes w£ys vet zhw zy£ oio oag Oab abn aph urC vhay vawr w£yw y£w zhaw ZZE 31- 39(1 Oad aby apn urd vhiy vayt wtya y £6 zhuw zzow ok. o?i Oak eb& epo urf Vlf v£yd w i y o w yga Zl. zor okr 0?£ Oan aboy epfy urs vik v£yj wiyp yiQ Zll zos oie o?h Oav a i d apoy ury viz v£yn wiys yli ZIOW zOr ol£ 0?l Bay a££ 8Q- urz vje v£yr wiy/ yowk zie z6f oln o?p 69? eik er)m ura vka v£ye wiyfl yowu zjt ze£ olv o?w 0«k 9tl 9Qr uray vki viyn w?y yowa zjow zaj olz i9l Oaws a£u 9Q6 usg vkw viyow ;.m yui zju zay olay iar Saw? aCz arjay usw vka viys ;-P yaz zj* za6 oluw e.d Oiyf 966 era us/ vkae viyO /-e yeae zkow zaek om. e.E 9iyz a£aw asa uth viae v?w yaev zkay zen o m o w e.h Oiya 9iay asf utk vm£ V?8 yawn zla zaes omt e.i &bl 9C? asn lay lap Ujl vmi voys J£l yaw? zl£ zaev onb 9.m 8£ae odl esu u/ow vmow w.ay /£ n yayz Zll zaw? onp e.t 6£? adt asv uyuw vmiy w.. /£v yiyz zlow zay. onr e.w Bff adaw asy uia vna wa. /fow yiya zl« zayd onv e.y &fl a£k atg uel vnaw waiy /i- yuwa zliy zayh onz 9-6 6hae afa atow uem vniy wa? /in yuwo zma zayl opt e.a Aim afd atv u?d vpa wdi Jiz yuwae zmw zaym opiy 9.ay Alt afn at/ u?£ vpEy w££ /ia z.t zm£y zayr OQJ 9-iy &ruw af& ate ADULT 612 1 1 1 1 1 1 1 1 1 1 1 1 (cont.) (cont.) (com.) (cont) £yju £y/u i y f a lyrae lyiyl £yjy £y/a lyg. iyr£y tyiyv £ykb £y/iy lygo lys. iytyuw ayos £yk£ £yyaw l y g a lys. lyuwt a y m v ayea £yku £yz. lygay lysw iy?l aybe a y m ; ay&£ £yky £yz. tyhow tysa iy?p awh. aybay aym? ay&i £ykz £yzC lyhay lyt. iy?6 a w h D aybcy a y n i ayad tyi £yzi l y h u w lyti UW- a q a a w i d ayi£ aynf ayeg £yld £yan lyim lytk uw.¿ a d h asE awit ayda ayng ayah £ylh £yow l y k o w lytu UW.E a d k « • g awi? aydb aynk a y a w £ylj £yOi lyl. lyv. uw.g aw. a d m as] aw]« aydd ayns ayaz £ylu £ y 6 a tylE lyvb uw.h 9WI a d n a s m a w k u aydf a y n w ayaO £yla £ya. iylj lyvh uw.l ew? a d o w a s r awlz aydg a y n a ay«& £yla £yab lylr iyvm u w . m a/C a d w atb a w m a aydh a y n u w Eylaw £yej lylu lyvp uw.r aj£ a d z atl a w m i aydp ayn? a y a m £yml £yal i y m b lyvt uw.z a/u a d a atp a w m m aydt a y o w k a y a n £ymn Eyam lyml lyvz u w . a a/w aeday at r a w n b aydu ayp- ayat E y m a w Eyawa l y m m tywa UW-? •yi aein ate a w n f a y d w ayp. ayaev £ymay £yay. lymv lywd uwar ayu af. av. a w n k ayd& ayp£ ayayv Eynb £yiyt iymo t y w o w uwbl azE a f d a v b a w n o w a y d a w aypf a y a y w £yni £y?. l y m a iyfa u w b a •zn afi aevd a w n p a y t m aypz ayiy. £ynl £y?b lymiv iyzC u w b a y ezae afn aevf a w n a ay£v ayrd a y u w n £ynm £y?m l y m u w lyzj uwd. azaw af& a v g a w n w ayf£ ayrm a y u w z £ynp £y?a tynb tyzm uwdr eod ag. aevm a w n y ayfi ays. ay?d Eynr ly.a iynó iyz; u w d w 80l a g i a v w a w n s ayfl aysl ay?f £yny iy-I iynd lyzy u w d a y a s m a g r a v z a w n a y ayfw aysu ay?i £yn6 iy.9 lynh lyzz uwfe e6iy ah. a v 3 a w n ? ayfo aysw ay?k £yn£y iyag l y n m lyzay u w f a aftow a h a a j . a w p a ayfty aytb ay?l £ypt lyak lynp iyz£y u w h a w a6a ai? a / o w awr. aygi aytg ay?e £yrt tyan iyn; tyof u w h i y • • b a]e »Jt awrs aygr aytk £y.£ £yri iyb£ tyna lyap u w h u w aeh ak£ a/3 awte ayga aytn £y.k £yrl lybl iyne lyar u w i m eap akf a z d awth ayhi aytp £y.t f y r o w t y b o w tyowa lyov uwiz a as a k g azk awts a y h a w aytr Ey.3 £yrr lybu iyp£ iyo0 uwj aay a k i azs awtt ayi. aytt £y.e £yrw l y b a lypi iyfi- uwjd aaz a k o w az& awty ayid ayty £y.ay £yre tyi. iypk lye. uw]£ a a n a k w a 6 y aw/iy ayir ayto £ybo £ysiy tyik typm lye. uwji a a v a k i y aOa a w y e ayiz ayte Eydb £ytow tyil l y p o w lyed uwju aay] al- afta awov aykd a y t a £ y d m iytp lyCm lyps tyah u w k n aayr ai. aa. awOk aykg aytay £ydr £ytr tyit lypu iye; u w k i y a£yj a i d a e d a w e ; aykk aytty £yds tytv lyCw l y p w tyad uwlf aiyj a m . a a h aw6c aykn ayva £ y d a £yt6 iyCy iypo tyag uwls a u w e a m b a a n a w a y g a y k o w ayvj £yday £yt£y tyd. l y p a tyal uwlt a?c a m g a ? a a w a y m aykr ayvk £yfl £ytuw lyda iyp£y iyaf uwlu e ? o w a m & a?J a w ? b aylc a y v m cyfr £yv. lydE typuw lyat u w l w •7v a m t y a?J aw?i aylg ayvp £yfa £yvb lydn iyn- i y a ; uwly a?z a n a a ? o aw?l aylm ayvo £yhy £yvh tydaw iyr£ lyay. u w b (com.) (cont.) (cont.) (conL) ava a.. a n v avn a b . a n z •vp a b n •vr (cont.) (cont.) (cont.) (cont.) a w a m ay.; aym£ ayzay a w b a w ay.a aymf aysd a n a awd. a y . a a y m k ayar a b u a p £ a w d a ayar a y m o w evz a b z a p i a w f a aybc 0VD a t e apt a w f a a v a a b a a q i • v a w a b u w a q w •vay a d b avoy 8W. a y a k a?fl a n b a ? a a w ? m aylp ayyay f y g t £yvn lydEy lyrh lyayy uwliy a . h a n t a w . h a w ? p aylt ayzf tygty £yv3 iy£m lyrj lyayz u w m E y a.t a n l a w . m aw?o ayliy ayzg cyha £yviy iy£r lyrl iyty- uwn. a . a a n o w 8W.I ay.d ayl? ayzn £yin £ywu lyfr lyrn iyEy? uwn£ a . a a n r a w . a ay.r a y m b a y z a £yiz £ywo lyfy lyrt lyiyd u w n / TABLES OF T R I P H O N E S 1 (coot.) 1 (COOL) uwnz uwaw ?n. uwnuw uwaz ?nC uwowb UW8& ?ng uwp. uwaed ?nj uwpr uwayk ?ns uwpu uwfyd ?nt uwpa uwtyh ?nw uwpiy uwiyv ?ny uwr. uwiyw ?n& uwrh uwiyz ?ow. uwr] uw?. ?owl uwrk uw?b ?p£ uwrl M ?pe uwrow ?.r ?piy uwrs ?.z ?puw ?rw uwrt ?-iy uwry ?.? ?r£y uwro ?ak ?riy uwrb ?aa ?sa ?sb uwray ?b. uwny ?b£ ?»g uwsow ?bae ?sl ?saw uwsp ?dr uwsay ?diy ?t. uws£y ?fa ?ti UWt£ Tfow ?tk ?tu uwtl ?fu uwtw ?fiy ?to UWtD ?gu ?tiy ?v£ uwtty ?ge ?wa uwtuw ?h£ uwvh ?hw ?Ju uwvm ?ha ?/e uwvr ?haw ?y£ uwvs ?if ?yiy ?z. uwvt ?im uwv? ?I£ ?zf uwwow?Ju ?zl UW/8 ?Iuw ?zn uwy£ ?ks ?zw uwz. ?kay ?za uwzb ?k£y ?od uwz£ ?lfl ?e. uwzf ?li ?ab uwzp 7lu ?ot uwzr ?lo ?eg uwzt ?luw ?em uwod ?ma ?es UW0. ?mi ?az uwflf ?mow ?aes uwOh ?mae ?aet uwflr ?awd ?awh ?avl ?ayk ?ays ?ayz ?aya ?iy* ?oy. oy.h ay-ay oyd. ay£a ay£n Dyil oylz ayla oyme oynn oynt ayn? oyse oyz. ayzb ayzi oyzt ayza Dyziy sy&a oyfiae Dyed ayat 1 (com.) 1 (com.) 813 8.10 TABLES OF WORD-INITIAL TETRAGRAMS 8.10.1 First Grade Tables of Word-initial tetragrams First Grade 305 then 89 dont 234 that 87 with 177 they 85 play 7 4 39 14 12 10 8 6 5 4 56 25 18 (cont.) (cont.) (cont.) (cont) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont) scho 172 80 have home some 73 167 abou know 71 157 time when 70 146 come what litt 55 name 53 down hous 51 ever once real sist yeah 50 here 49 didn 130 like 68 your 128 this 66 brot goin 124 ther 45 65 from them 44 64 thre gran moth 43 want 62 thin 41 coul 57 over 39 does 56 east just fríe 101 beca 97 were 94 went 91 well 47 othe swim only work even mine 24 much 38 four righ 17 said shes talk caug 35 thes him. cant used hors watc nigh 34 wher pool fath ride room 23 says take away squi mommtell 33 thir wate alwa baby 22 16 came mean anot bask five jump 21 clos fish firs 32 more gets dadd oclo make woul out. mone stay morn 30 shoe goes 20 slee star call thou eggs too. 28 eigh whol back next nine 15 27 turt big. one. bird 19 long 26 gues made look hair seve walk thos toot turn year 25 14 kind 18 live arou afte almo babi blac clot door fall feet fell girl mout ones read stuf than thro took week whit lady sick last six. love stop miss stre need summ neve wasn rabi whos 9 anyt say. yest boys soft yet. brin supp 11 crib two. 6 foun unti all. ball catc gras wish aire bear dim half 7 been colo head agai bett cous insi doll kept bath buil good less beac cart hawa line bed. coun 13 hund lunc bigg craw aunt left pers bike davi birt stor bite days lets bunn old. teac brou did. camp doct chan peop trai debr pret unde clif each died toda wend club eati dubl edge dog. twen ftinn 8 earl fast grea 10 aero elev fina high anim and. exce foil into befo bonn eyes hams rabb brea cand fami hate fift hosp stil cats cat. floo chic find hurt 12 forg clas free invi bill game day. gett joke brow give deep happ late diff keep dian her. laug dinn kill else kath lost dogs kitt feli minu lots gave many food most migh hand mexi frog open monk hear hold move plac sand teet thei very you. 616 outs pull snow span stan moun nice numb nurs off. pant PCPP reme shot show sixt slid sock soon stra sund tele told tree unci jim. kidd kids lesl nois now. pict piec pony push radi raft rain sere shou side skin sold Stic tabl tail 5 tige blee vaca book wake bott wash boun whee boy. 4 brok cent andy chri anyb clow bloc cold both comi bump ding bunc eat. car. foot cast geor cave gian cour grad doin guin face hole farm huh. film fing fran fun. gold grou hang hard havi hide holi hung isnt john june laur legs lisa mama mars mayb mela mich milk mont neig olde pean pig. poli rais ridi rock roun sera shir sitt skat skel smal tara tiny tons trac trip usua vee. was. wein wet. wind wont writ 3 acci addi agne ago. apar arro atla bank bare bars base bean bedr bell boar boat boug box. bran bun can. card care chai chal circ city cock coll comb TABLES O F W O R D - I N I T I A L T E T R A G R A M S 617 (con«-) (conL) (cont.) (coni.) (cont) (cont) (cont) (cont) (cont) (cont) (cont) (conL) (cont) (conL) comp pick corn pige era pill danc pond dead prac divi prob dott race drag repo dres rest drin roof drip sam. driv same dune see. ears sent eith shap enou shar enve shep fan- shop fire sing fore slip term spla g h , spri r » y stri grew sure guit task harr tear hobb test hopp thum jack thur jimm tick Jung tisk kick toge knee tong knew tran lake twel land unle lick vale liza wait loos warm man. ways meas whic midd whip mind wils mons wond mous wood mud. word not. yes. okay 2 park pate acad pete aeol phon ahea alon anym anyw aske asks avoc bad. bag. bale bana band beak beat behi bitt blue boot brae brak brus bubb bum cage cake calf cali capt carl ceci char chas chin chiq clau elea cost coup crac cric crun cry. cryi cubs dach desk dieg dime dirt draw drew drop draw easi easy eate elea end. engl expe feed fenc flgh fini flic floa fort fron turn giga ginr gots grab gree hart> help hidi hoU horn hot. iclcy indi in te jane jerr jets jill kais kite lear macp magn maki mart mist mond moon movi near noth onto oper oran owne pain pan. part peda pen. pets pish pitt pneu poke pole quic reas regu ring rive roll rope rrrr run. runn runs sant saw. scie seco sept slap slow snea soun soup spel spoo step stev stom stup suit swin taki teen terr thri toad tomm tomo trie true tryi tuck upst wall whal wide will wint woke wow. wron wrot yank youl youn 1 addr adop afes aha. airp aliv alio amou andr ange ann. anns any. anyo are. aren argu aski audi avac awhi badm bake barb baro beco beet bein beli belo berr besi best betw bicy biti blon blow bob. bond bone born borr bowl bozo brav buck bugs bumb bun. buri bush busy but. cabi cafe caff canc cany caro carr cee. cees cere chew chil chop chuc ciga doc clou coas coat coff coin cone cook cott cows crab eras cray cros crum crus cub. cubb cuts cynt dad. dads dair dand dare dark daug debb deci denn die. dish disn divo dran dump duri dust dyin dyna earp effe egg. eile elep elle elsi espe evap eyeb fain fane feat felt fict fixe flat flyi frid full fuzz gara garb gard gary gate ge» gee. gigg gira glad goat goos grah grey gris guys had. hah. hall hami has. hat. hats heat hers his. hits hope hops hour how. huff hum. ice. impo inst iren itll janu japa jars jenn joel juni kah. kang keys king knob knoc knot lab. labe ladd lamb lanleas leav leis lett lief lift ligh limp lind lion palm list para load paul lock paws lose pay. lot. peas loud pell luck penn mach perf mad. pett mamb phil •nana pigg mara pine marg pira mate pism meat plat meet plea men. plug mena pota merr pott micr poun mile pour mill powd mirr pres mixe prof moms pudd moni puff mono pupp mose purp moto purs mush puss must puts myse quie nail rand nata ratt natu ray. neck raym neit reac nobo rece nort refi nowh rena nut. now oaks road ocea robi offi rode ooch russ oreg rust osca sack ouch sail paid satu pail save pal. savi sayi scab scar scot scou seat seaseed seen sell send serv shad shed shee shet shoo shor sidn sign sill silv sine size sky. slam sled smee snac snak snap sore sorr spac spea spen spor spot squa sque stai stal stat stee ston stuc stud subm such sunn surp susa suzi suzy tall tenn tent the. tigh tim. tips tire toby toca toe. toes toma toni top. tort town toys tras true tues tumm tust twis type ugh. ugly unic univ unlo ups. vase vick visi waps wast wear weve whan whil who. wido wigg wins wiza woma wool worl worn won wowe wowu yard yell yum. zero 8.10.2 Third Crade Tables of Word-initial tetragrams Third Grade 274 then 86 your 51 time 234 85 know goin 49 hous said 78 them 48 yeah scho 209 take 77 this 47 abou 204 just thro they real 46 164 76 says have beca 43 145 74 back like come over want 144 40 when 73 coul brot 141 39 72 sist well dont star 133 what 66 38 ever here 132 name ther 58 37 didn 112 down goes went with home 2 6 i that 108 56 some litt 100 thin 54 play 98 were 53 righ 34 25 look firs took supp wher 24 33 door head eigh talk made thir 32 from 23 moth wate room 22 31 away fath hand four mean kind thos make year 18 anyw frie into teac 17 cous fiinn good him. last Ugh one. side tell thou toda 14 gets gold high part ride shou 13 bath bedr befo bike book cand chic comi did. east 16 give 30 21 anot kill bear neve alwa call girl miss fell next open happ nine 29 sund keep sere movi sick baby five 20 shes slee only birt stay step doll stuf stor 28 half too. trie reme read work watc satu you. 12 woul seve agai 15 anyt used 27 figh aunt afte 19 fire chai 36 bird ball fish fift came lets cant snak gran does nigh hors snow jump othe once live unde more thre thes out. walk morn plac whol prêt 26 twen 35 two. arou turn 9 8 11 ( c o m . ) (cont.) beac spid Mac off. elea pick squi each piec stop fall same than foot stra trap fort unti whic kept wasn 7 oc lo wear peop whit almo rock wind alon see. wood best bett shot 8 camp told army chri 10 bloc dim bone blow clot face boys dadd fami clos dres fran cook grad hill craw gues hope forg hate lady fron hole many gave huh. mich gras hund pape guy. lisa pict her. lock stri hour nose tick inte old. whos knoc rick left rubi 9 love scie and. lucy skin chan lunc soun cost mist swim fina mommtoge fing moun tree foun olde wall guys ones was. help scar 6 kiki seco kiss ship apar move skel band 620 6 6 (cont.) (cont.) bed. blew bloo boy. brow chil clas crac cree day. died dirt else feet grav grea grou hear hold inst jeep junk maki migh mill mine minu mode mone mous paul pres pull push runn scou shar shoe show sits smal spoo stil tail thei trip very weir will worm wron youl 5 (cont.) long lots mice mike navy okay outs parr prac seen sell 5 sitt abse slid been spit boat stom bomb stre broo teet care tige caug trai cave tras cent trou circ true days unci denn vaca dinn wash dino week dish who. elev witc even writ find yes. floo yest game yose gara 4 ging greg abbo hall ahea isla atti jane babi jayj balo kitt bask layi body lond born 4 4 (cont.) (cont.) boss both bott brai brin bump bunc bury cake cart catc chew chur dads dark deep diam dog. drin eat. elis eye. felt fool glid gone goph guin hang hike hits hitt indi insi jewi job. kick kidd laug laun lead leav list loud magi meno mens mexi mile moms mons mont mout much myse nois noth nurs ocea park pill pink plan rece reco ridi roar say. sayi sera sing skip smel sock sold sort stee summ sure surf susa tied tomo toot TABLES O F W O R D - I N I T I A L T E T R A G R A M S 4 3 3 3 2 2 2 2 twel wait wave whil wish wrap yard cart eati eeyo eith engl expl feel fict flas flew flow flyi food free full fun. gard glas gren grif grow guns hair hard havi haws hiki horr hunt hurt inch iren joke kinn knew ladi lear leas libr lick limp lola lorr lost luci luck mad. man. marr mast mess mind most moto nice nope not. now. octo pack pain pass pean penc pers pete pigs prof prow punc pupp rabb rest rich roll rose rott scis scor sets shee shir shov size skun stan stev ston stup subm swin swor tabl taki tale teth tore torp touc tryi tunn uhuh usua welc whis wild woke wond wors yarn yell youd zoo. buri bush can. cann carr cavi cele cell chih clem coat colo cont couc cour cove cowb crab cray crit cryi cubs Hula dang dear dent diap digs dire disn divo dogs dona donn dran draw driv drop dust dyna ears elbo empt end. eyeb eyes eyoo fair farm fast favo feed fell flat fore frog gail garb germ gett glue gosh gree habi had. hadn hann held hell hide hose hosp hung invi japa jet« joan keit kid. kids kite knee lace land lap. lass late lays less lift liza log. logs magn majo mama marc marg matz midd mili morr nail nass naug neat neck neig nick orde ouch owns padd para patt peck peek pie. pitc pits pizz plea pois poor prim prom pudd pump puts rais regu ring rope roun rowe rubb run. sauc saw. scab seen seaw sent serl serv shac shut siam sill silv sine sixt skat slip smas soap spec spil spot sub stai stic stoc stol stru stud tall tast tear teas tele tent tire trac tram trol true tues turk turt undr unit unle upsi vale vee. vick visi way. wedn wet. whee why. wils wolf woma york youn 1 (con I.) (cont.) (com.) (cont-) (cont.) (cont) (cont) (cont.) (cont) 3 also any. aqua are. aren asle base bite boar bowl brea buil butl butt cabi cali card cast chas chec clam coll comp com coun coup crai crea crui cupb cure cuts dair dart dead debo desi dest digg dogg doin doug duck 2 aero actu adda adds air. alex all. alio aire amer anim answ anym arch aske atte audi aven avoc awak axis bad. barb bars bass batt behi belo bend beta big. bit. blou blue bolt boom boun boxe bran bren bubb afra ago. aire airi alca alga aliv alle alb alum ange anns ants anyb anyh appi apri arit ariz arm. arti ash. aski awfu badi bags bana bang bank bar. bare bark banbawl bead bean beco beds bedt begg beg! beli bell 1 belt able bene acce benn acci betw acid bewa acti bigg acts biti adde blan adve bond 1 1 1 1 fine flak flam flie flin flub flus fold for. fore foug free frui fum. fum garm gate get. ghos gigi godf goga goon gori grab grew grey guar gupp gush haun hawa hebr heid helm hims his. hobb hogs holl hono hook hops horn how. huge hump husb ice. idea impo iron isnt itch itll its. jady jame jami jani japs jaso jeal jean jeff jenn jerr joe. join judy juic juli jung juni juve kay. kell kenn knif knig ladd lake lark lawn leglegs lemo lett lewi lind line lion livi load lot. maid mans mark mayb mayo meas meet melt mena 6B1 1 1 (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) crow cram dad. danc dam dass date daug debr deci dee. den. desk dick diet dieg diff disa doct dodg done dope doub drac drag drov ear. easy eate eats edge egg. eggs ende endi enou ente equi esca ess. euro exac exce exci expe fake fals CO IT famo cows fars eras fat. craz film crib filt bong boo. boob boos boot boug boul boyf brak brat brid bruc buck bunn bum burp bus. bust cafe cany capt car. cam caro carp carv case casu catf cats ceci cert char ches choi chup ciga cila city clar clay clif clue cock cold cons corp men- pile mete pine micr ping milk pit. mise piai moll plas mom. plat mond poin moon poli mudd pong mumb pool mump pore must posi myst poun nanc powe nap. prin natu prob nava prog nazi pron neil puh. neit purp neon quae neph quar news ques nich rain nint raki none rams note rang nut. rat. nutt rath offi rats oran ratt ough rays ours retu own. road owwu robb page roch paid romu pant roof papa roos pari rot. pat. ruin path rump paws runs peas rush pest saqr pet. sain pett salo pew. sand pies savi pige teal Pig« sea. THIRD GRADE 622 1 1 t (cont.) (COM.) (COM.) sear seat ' seed seek seme sen set. shag shak she. shel shhh shie shoo shop shor shuc sizz skee skir skos skul sky. slap slop smar smil smok snac snai snea snee soak soda soft soon sore spac spag spea spen spin spla spli spon sta) stat stea stew stif stin stit stuc subs such sudd sulp suns supe sur. surr suza suzi swal swee tank tape tapp taug teen temp ten. thea thtw tide tiny tipp toas toes toil tomm topi toro toug towe town toy. toys tría trie troo trop try. uhwu undo unge unlo vacu veni voll vomi vulg waah wagg wago wake war. ward wast weat wedd whem whoe wide wien wins wits wolv won. wont word worl wrot yach yeeo yet. 8.10.3 Fifth Grade Tables of Word-initial tetragrams Fifth Grade 373 133 know just 346 that 329 they 275 like 228 have 224 then 181 this 174 well 173 yeah 125 dont goin 119 ever 118 thin 65 litt teac 63 name 62 come does star 58 107 coul them your 56 miss 105 said beca 55 95 othe went says 90 with 84 172 over what 79 16S play when 78 163 real ther 76 155 time were 73 144 down abou 72 142 didn some thre 52 back 51 five moth righ want 50 scho shes work 48 mean woul 47 take used 45 24 33 18 from (com.) away (conL) room even gave coup took gran doU 43 each ash 32 23 into good anyt anot jump cant frie kids 42 kind neve long brot read wate minu girl mist 31 22 pape 41 wher came plan thir goes sort here 30 twen stop thou book than 21 toda firs 40 thes her. alwa make 17. 29 mont baby 38 show next foot arou thei seve guys sist thos supp keep watc too. milk 28 most 37 him. 20 will afte hous feet look fift 16 36 tell home chic fath lets happ week 27 made many head plac stud 35 nigh unde trie last one. 26 19 15 only eigh agai also year four live ball half mine exce 34 peop prob fami give thro shar hard talk you. told isnt kin 33 25 18 move call once caug movi 13 15 (corn.) (COIIL) 10 all. pull seco aire spel stam base surf tryi beac swim whol brok wasn yard clas writ yest day. died 14 12 doin befo aero elev cous been engl did. boys frid forg catc fron funn days grou gets hand hear hair migh hill hell pret japa midd rock mich poun mite test much thur ride nine send 11 shot part reme best sick stay bett stor stuf bott twic summ care wres usua dog. very figh 9 brin walk fire gett cany 13 high cats arit kept chan both knew dead eggs coll list grad more eith grea ones else hate open free hebr prac game hors scie gues hund shel mark stan mile off. out. wont nati now. rope yell 624 9 8 7 6 5 (com) (com.) (com.) (com.) (coni.) fall favo flub food glas gold hike hour inst kell lady leas lett lune 8 matz moms abse addr mond 7 ahea mone pick and. afra aske almo prog bird alon 6 rive boy. answ amer roof brea anyw apar scot bubb ariz bath scou card big. bloc smar cent bike bloo spor clos bite brou taki cold blac cert touc draw bunc chai trai driv butt comi trip eyes club coug two. fini coin dest way. fort cree diflf west foun door divi woma gone drop doct youn dogs guy- fell 5 king havi done lear help duri acci left hold enou acco park kill expl adri pets lake face alio man fair pict are. old. parh pool ques rece salt smal soft stat stic stil subj wash piec pier same seen sitt stre sund team tele tenn turn unci wait whit wond word marr not. okay outs pers pupp quit repo rich satu shed shou spoo sure tree trou wort wron yes. atom beck besi boat brit case chal chil clar dim cont craw dang deci desk dick disn dodg earl easy fast had. hobb huh. hurt join late laug libr lock lost lot. luck mask maud mayb mess mill mind morn must nice T A B L E S OF W O R D - I N I T I A L T E T R A G R A M S 825 4 4 1 1 4 3 3 3 2 2 2 2 2 1 5 (coni.) (cont.) (cont.) (conl) (com.) (conL) (cont.) (cont) (com.) (conL) (conL) (conL) (conL) (conL) (conL) oper pain pene pian race sayi sera seem seri shee shov shut side sits sixt skin slee soun step stev stoo stra susa vail vist was. whic wind wrot youd 4 abov acre airp aite anyb aprì babe band bare bein belo belt beul bigg bill bomb boni boss broa brow buil camp cat. chec chih chri claw clou colo cook couc cour curv cute dads deep dera dirt disc drag dres eddy eye. feel fero fran full getgolf gray hall hims hum. isai jock john kick knoc laun legs less limp lind liza lorr lots maki man. marv mcdo meet moun neat need neut nose noth oclo offi palb pare porp prin push ramp raw. reas reco road rode rubb sail schw sere seat see. sees shap shoo smel snee snow soon sore spec stom such tail tall ten. tent terr till tiny toge trac tras turt unit unti vaca virg wave wear weve wide wort yose youv zero 3 able ago. alle area argu assi augu aunt awhi babi bad. bask bear bedr behi birt blam bom brae bump bush caps car. carl caro carp cars cart caus chas cinc clea clov conc coop crac cris cubs deal debb degr desi diet dust eati eats elec engi enve espe etce exac exag farm feat fina find flea foil fool fres gary gate germ gosh greg hers hitt hot. hung hydr init inte jeff jewi juda july kath land l«g leno line love macc male mart meta moni mous mule musi myst nail neim nick nobo nurs whil oppo who. ours why. P * 8 e wing wish peri phys wood plea WOTS poor wris post 2 pres priv adju publ adop quie amou rais andy rein anim retu aren reve arms ridi art. roos asks ninn asso sari attr set. audi shak awar ship bald shir bark shoe barr shop basi sign bass sing beg. size beli skeg betw skii blan snap bias spea blee spla blis spot blue subs boil tabl bonn tack boot tear boxe teen bren temp brid thum broo tied buck toky burr tort busi toys bust twel cali twin can. unus cana upsi capt wedn carr cast cave ceme cham chem chor chur clot coat colu conf conv copp coun craz crib cros crum cups curr dach danc dann dare daug dear dese digg dire dive donn drin drov dran dubl earn east eat. edge eeyo eggendi euro eve. exch exer expe extr fact fain fals feli fiel figu fine fins fiss fitn flag flat flin flip floo fold for. fore form fost fun. fum gara garb gayn gear givi glid got. gree grow hate hibe hips hmm. hook hosp hote hows huma hurr idea imit insu isla ital jack jame jell jets joan job. joke june kidd kite kite knee lang lati layi lean ligh link livi lous lowe lucy lyin mago mali mate meas meat mili mino misc mout muff muse myse nanc navy neck netg neit nois norm nort note noti nut. oeea olde owns pal. pame pant pari pass past patr paws pee. pill pipe poin pois poli pood pop. pore pota pour purp puts quar rand rang reae redo reli remi rent rest rick riot roug roun sane sand scor seub seda sell sepa sequ sets sett sine sir. skat skip slip slot smas smil snak snifsoci sock sout spar spee sper stee stri stuc subm sudd suit swee swin swiv tape tarp thic thun tire toad tomo tore toug towe tria trie trop tues type unif unie vee. vega venu vick wall warm wast wavi weig wet. whee whis whos witc worm wow. yeow yet. yoko york youl zeke 1 aban acto actu adul agre aile aint alab aliv alii ankl 4P ti an to anyd anym anyo anyp arm. army arre asid aski ate. atte atto bain bake bals bang barn bars batt beag beat beau beds bee. begg bela bell bene bet. beve bibl bicy bing bipl birm bitt blin blow boar bobb body bore bost boug boul bowl boyd bran bree bumb bunk bum buse busy but. cage cand cans cata cath char chea chee chew chip choc chuc circ citi clai clam clay cler cUf doc coac cofT coke cole comp cond conn cons copy core com cosg cove cowb crap crat cray crea enm crit crow crys cupb cuss cuts cutt cycl dad. dadd dais damn dam dash davi davy daws debr deca dece deli denn dent depe depo derr devi devo dew. diag die. dime dinn dino disd disg disp dite divo dizz dock doub doze drai drew dry. dump duty eart ease easi eauk eddi educ emba enei 626 FIFTH 1 1 1 cnde ends enjo excl extc eyeb fake famo fat. fenc few. All film fine fite flap flew flow fluf flut fly. flyi foil foou fore frig frow froz frui fudg furt garn gath gayl gene geor geys ghos gian gill glad glea glue goal goat gobs goU goof goos goph gord grif guar guit gum. gunt gupp gutt haas habi hadn hale hams hang harr hass hawa hayl heat heav hedg held hens hes. hiki hist hits hole holl holt hono hope horn horr how. husb iden igua impo impr inch incl indu infe inje insi iron issu itll jabb jake janu j«yjayn jays jazz yea. jenn jero jobs joe. jose judy kati kenn ketc kid. kild Icnif lamb lane lann lap. larg laye lead leak leap leav lens liar lift lila lip. lips lloy lodg lope lose lumb lung magi main marc marg mary masc mass matt mccr mcho medi memb men» metr mick 1 1 1 1 1 rose rout row. safe saha salo sant sard save saw. say. seal scar scoo scri seal sede sent sept sepu shad shag sham she. shei sher shmi shor shuc sido sink six. sixe skel skim slep slic smir smit smok snea sogg sold song sorr souv span spin spli spra squa sque sub ster stin stro stun stup styl styr suba succ sue. sull sunk sunr susi suzy swal swam swor swun syll syri talT tank task taxp teat tedd term teta teth thax the. thri tigh tina tips tisk toes tole torn. toms toni tons toot top. torn towa town trom troo true true trot try. tube tune turk typi ugly uhah univ uppe uran urge vani veil vete vict viol vodk voic vole volk voll volu wago wale warn ways weat weir welc whal whar whet whip wife wine winf winn wire woke wore wrap wrig yach yawn yvon zeal zuri (com.) (cont.) (corn.) (cont.) (cont.) (cont.) (cont.) (cont.) midg pine ming piai mixe plen mode pluc moon plun morr plus moss plut mote pock mud. poem mump pogo naw. pomo near pony negr popp news pore nint pox. nix. pray nixo pref nope prev numb prie oaks priz octo prod odds pron olds prot ooh. prov oran putt orig pyro ough quee outl rabb own. rabi pace racc pad racq pack radi paid raff pals ragg pam. rail parr rain pat. ran. pate rane patt rect payi red. peck refu penn rela l*PP remo perc repe perf reti pert reyn pest rifl pete ripp pctt rodr phon ron. picn ronn pige roon GRADE 8.10.4 Adult Tables of Word-initial tetragrams Adult 28 arou some woul didn 265 neve 76 44 thre they your when 225 26 know 74 40 negr ever peop week 186 73 39 25 well with inte clas from 162 67 37 kids what scho much teac 151 righ like 62 24 goin 36 othe been prob 149 have 59 work talk then 136 35 23 ther 58 here said beca 135 mean 34 22 just good back 55 part down 129 wher litt thin 33 53 more 21 121 them take hum. yeah thou only 50 thes 110 want 31 dont cant 20 48 psyc thro 106 went time abou were you. 19 alwa 47 91 30 anyt this year coul give high into 84 45 over most real very thos 330 that 84 45 (conL) (corn.) 14 11 18 (corn) kind eigh live taki inst many thei isnt says name 13 play 17* chic shou Win colo stil girl enjo than grea feel took happ grad word last hear look hope 10 mist keep anyw nigh long care seme love chan tell mayb coup whic plan driv sort game 16 star matt cour stat stud even swim tran test firs true told walk 15 too. 9 afte watc befo whol agai come base doin 12 coll drin camp dist four difT form life expe hour make gues lets plac huh. majo pret lear need show, next shes now. summ 14 phys unit bett satu whit does seem will Hous sure youv nine twen sixt 8 surf book (com.) (cont.) (COM.) (cont.) (cont.) (cont.) 7 6 5 busi came chil club coun depe doll fell find frie half hall leav move noth pers pres quit reme sant smog soci sout supp tick tryi typi worl minu moni moth once pare pass rath seco seve sign stuf subj such type wond lead memo mont one. out. park phon room same see. spen stay twis was. wate youd exci fina fort free geor goes hard home hoot idea incl juni lang leas main marv must myse narc nice nobo numb oclo off. orde phil pool poun ques reas rela seen seni sine sing tele thir used wayn wear weve wont 8 6 actu adva and. begi coco cred deci disc diss dodg door else 7 eyes acco five anot fran fron call done fun. eith guys hami fiel lift hand funn help gett him. job. imag less kidd livi kill 628 5 adve almo anyb apar are. aren away beco bein betw bloc boug brai chal defi deli depa divi doct duri each educ elem enou 5 4 youn laps lose 4 lot. ago. mali mois all. also norm ange noti answ ough area pick army poli asha prov besi regu beve road bigg sen boar shar bom silv bour snap span cali card spor chea stop clos stra comi tree comp trie cont trou deal unde dinn wasn easy worr elev yell engl yes. expl zool fact far. 3 foot able gets abov gone addi gosh airp gram aire hawa amer hill appl isla argu john ariz join ashe 3 3 aski aspe aver awhi baby bad. beau birt bitt boat body both boys brig brot buil buye carb cars cee. cert city comm conv cope culv day. dayl days deve drai egyp emot engi espe exce fair fant feet flew folk for. g»ye gene gree grow guyhate heig her. hund husb husk impr kick knew lawn lect lunc made manmath medi meet miam mili mole nece nois okay ones open past plug preg push putt quar rat. reac read reco repa repe (cont.) (cont.) TABLES OF W O R D - I N I T I A L T E T R A G R A M S 3 (colli.) reta rewa ridi risk roug sayi seer seei self sens sist situ smel soun stan stor stre sudd suff supe swea syna tape toge trav turn unci unif univ vee. wait war. wash way. whil whos writ youl 629 2 1 1 1 1 1 1 1 1 2 2 2 1 1 (cont.) (cont) (cont.) (cont) (cont) (cont) (conL) (cont) (cont) (cont) (com.) (coni.) (cont) (cont.) assi aunt auto ball band barb basi beac bee. beli bill bisc bit. blen bloo bonn bori boss bowl boyf bree brin but. buys cher chip choi chri clot cole cook craz date dave davi dire dogs dope drug 2 easi abel east abso ente acap equa acci erwi aero està agre face agri falc alco fami alon fart anyo fast aort fath appr felt floo flyi fore forg foun fren frid givi golf gorg gove gran guam guit hang havi head hold hops horr hors huge huma humo impo indu jobs kept labo lawy left lega Icon line list loca loom lost luck med. ment mexi migh mike mile miss mixe moon moun movi naw. near news not. nuis obje offi olde oper opin oreg pack pali pape pere perf plia poin poop pota proc prod prog pure quai rabb race raci rafe rain remi reru rest ribs rich sand say. scie scub seas sent sept serv sham sher sigh sits sitt skin slee smil smok soon spac spec stew succ surp swee tahi ,taug teet tent the. toda tomo touc trea trem trip twel twic two. unti uppe upse vist warm wave ways wedd weir whis wild wish wome wood wors wron wyom yank yest yet. york affa affo afra agen ahea aiml aire amaz amos amou anat ande andy angl anim anne anox anym appe aque asht aske asph asso athe atte augu auth awfti babb babi badi bars bask bath beer bega behi berk best big. 1 bioc abno blam acce blea accu blon blow acti adap bobb addr boil adhe bore adju bost admi bott ador boy. brea brid bril broa brok brow buel bull bunc burd cabi cafe cal. can. cana cany case catc caug caus cent char chee chem chev choo ciga clea clif cliq coac coas coat conc conf conn corn corr corv cous cove crab cran eras craw cres curr cust cute cuts dadd dama damn danc dang dare darn deaf deca defe defy degr dema demo depo depr dese deta dete dice did. dime disi diso dog. dorm drag draw drop drov dumb dyin eati effe eise embl ener enti esco escr esga esth euro evad evil exac exha expr extr eye. fabu faci fag. fall famo fasc faul fest feta figh fine fing fink fire firi fish flat flav flip floa flor flow foil food ford fore foul frat fres freu friv frog full furi fum gamb gave gear get. gian glam glor glov goal grou guil gung gurg hair hash hasn hers hist hitt holl hone hop. hopi hosp host howd hugh hung hunt hurt inch incu inde infe infr intr invi invo iren iron itll ivor jail japa jeff joke jose jour jump Went kid. kirk knee lady lane late lati laud laug law. leag leak leec legs lens lett libe ligh logi lond lots mach madl maki ozar man. padd mana paid mari pard. mark pari mars patr meal payi men. pear mess peri meth pete midd peti mill phar mine pict mino piec min- pine mise pitc mise pity mome piai moms plea mone plus mono pock mora posi morn poss mult prea muse pref musi preni nami prin nati priv natu prof navy pron neat prop nerv prot new. pubi none puis note purp obey purs obli radi obno rapi octo rash offe rats ohio razo rebe oil. old. rece omin refr onio relo opht requ orbi rese orga rete orio reve ours rhyt outd ride owne robe roll rome rosi rott rain runn rush sail sain sara savi scie seri sea. seat seeg sepa she. shei shel ship shop shov shri sick side sill sink slam slid slin slip smal smar snee soak soph soup spee spit spli spok spon spot spou spur stad stag stea stic ston stri subp suit sunn sunt surg SUIT surv syra tall tant team tear teas teen temp terr theo thie thri thru tiny tiri toni toot topa toU traf trit trut tues tung ugly uni. unle unre upbr usef usin usua vaca vein veni vern vitr voic waki wand wast weat wedn west whee whet whew who. why. wide wind wine woke wrot yout zoo. 8.11 TABLES OF WORD-FINAL TÉTRAGRAMS 8.11.1 First Grade Tables of Word-final tetragrams First Grade 303 then 82 with 183 ther 71 bout 167 have 70 ster 159 that they 69 ttle 152 when 141 know 123 like 117 here this 101 •use 99 what 93 were 91 went 90 well 87 dont 24 ally hers baby 48 esnt come 33 hese once hree ies. ming name 46 out. 32 ter. ould some ouse used 49 idnt 34 (conL) 45 31 68 from came shes home 43 66 eres 30 back oing time 42 goes ere. ound 64 hool yeah hats imes 40 29 down even 63 them now. hing one. 39 room 61 only take ting ing. 38 59 real 28 atch ight 37 king 58 ways 27 hat. 36 day. pi«y her. 26 56 said very five just ldnt 54 35 want your ught 25 34 hem. 52 over cant 23 addy 22 hose 21 eah. four ommy ping 20 ends ever mean next omes ool. use. 19 ning 18 ings more 17 anted ding him. kind 17 (com) 14 11 9 8 (cont.) (cont.) (cont.) (cont.) much fell ride ght. uess iend inc. 16 old. tell all. away than ers. und. eyre gets 13 hink does hole dog. most each ome. hair rent irst ring irty says mine stay ndy. talk nine too. ten till 15 took akes 12 and. big. fter ime. gave lied heir long his. made into mes. ish. ndma ives ones jump own. lets rted live side oom. swim oure unny teen walk you. ying 11 14 ame. ears ater aunt lock lack mped lose nder nted ney. ooth nner orks nny. pped ocks reat oked ons. ree. uff. rned ven. ross ving rown rrel 10 rson call tart door way. eady eeth 8 eggs ace. fall ain. fish ames ggs. ants hoes ball ied. cat. ople ebra ough eet. outh enty pool girl thes good unch hold ite. 9 ive. ange keep cats lace dmas lady een. last etty left fore ling hite make ide. many kept mber leep nds. 632 ntil ood. ore. our. pull read rib. say. ses. sket tand two. 7 6 (cont.) ( c o n t ) open oved rse. rty. sins six. tie. ties turn ver. waii work yesyet. 5 (cont) nday iant need ind. nts. inea oes. jim. off. kids oke. lass orse late per. les. pper liff rgot liar miss rtle sick move told ncle 7 tor. ner. ture ngs. aby. wish nice ack. 6 air. andy nies alk. ard. 5 ntic ooks ant. been alf. arly blyu alls osed asnt boys ands raft rass bed. ches ast. rds. bies did. ate. body dpas athy red. cept ead. bike reet days edge box. sand boy. snow deep elix dogs else ched soft eeks ent. cher soon feet find ddys tain hday give dred tens hes. half eard tion tten iane hate eat. kers head endy umps ily. erry ket. land eway 4 line nish lay. fast ach. ock. llow game ail. high airs oday lots ogs. love hone arm. oney mbed hrow ars. oor. mmer huh. aybe 4 4 ayed ays. bear ber. bird bit. bite bles both bra. can. car. club ctor ddle end. enth eone ess. est. ets. food foot frog fun. ger. gers hand hear icks ico. iet. ikes iler ion. ird. ited ity. ived june kes. kets lide llet look loor lor. lost mats man. mas. ment ndpa ngle nkey nnel nnie nuts oise ont. oth. oys. pas. Pigport rday ried rts. sery shot si Is sold sons tal. tty. ugh. urse utes uth. vee. vid. was. wash week (cont.) (corn.) TABLES OF WORD-FINAL TETRAGRAMS 4 3 3 2 2 ade. adio agut aid. aii. ails ains aise ales als. ank. anta are. ark. arty asks ason ass. aten athe aura ave. avid bad. tngbars bell bers bill bing ble. blue boat book bor. bors bump cake camp card care ces. chen eked cle. cold cond cry. cubs dais dead ded. dent dest dma. dnt. dow. drew eaks ean. eany eart easy eath ecil ects eeps elet elf. ells elve eman ened ents erd. eth. eton ezes farm feed film gher gia. gots gry. hbor hey. hick hile hird hout hurt iana ible ice. ich. icky ided iece iego ier. ife. igh. ilm. (conL) (cont.) (cont) (cont.) (cont) wet whos wing xico zard 3 •CCS ago. anic any. aped ares ats. aved bulk bbit bits cing cken cks. comb ddy. der. died dio. doll eday eep. eft. ell. ence ens. eter eyes fire geon gest gger gnes gon. gray grew gue. hael hang hard hen. hich hide hot. how. hrew ose. ifty oat ike. oup. ill. owed illy pet imal push immy race iner rade ink. rang ins. reek iris rel. isnt reb itar ten. ith. rks. its. rman knew roke lake rows lar. rrow led. rst. legs rush less rzan limb sam. lisa same Iked see. Her sent Uy. shed lub. show mama sion milk skin mily skit mmys slie mud. ssed nee. ssus ncie stop ned. sure nes. tes. nia. test nie. tiny not. ton. nows tore nter tree nty. trip ody. try. okay tuff oles uilt olor umb. ong. urns ony. usin ook. wont ooms oon. 2 ored ably 2 (cont) ions inly iri. irs. irts ise. ised iser ital ixty jane jets kate ken. keys kill kin. laus lded ler. lest lian lice lie. lis. llys low. lows lse. mind mmy. nch. neak nee. nged nger ngry nnis noon nowy ntry oard oded odys ole. ond. onto oons oot. ope. ork. ors. 2 2 ots. otty oull oves owns ows. pan. pany pen. pespick pole pond rabs rain rawl reus reak reen rest rget rink rite rock rogs roof rote rrrr rry. ruck run. runs saw. sday self shoe sing sked slow snt. son. sted stly stor tail tays tch. tear ted. tend thy. tick tmas torn. tons tory tter ttys tub. ughs ugs. Ulto ular uld. unes upid uple urt. uses vent ves. wake wned wns. woke wow. year 1 1 1 cie. cko. cky. cles coal coat codo coin cope corn cost cows cret crib cub. cus. cuts dad. dads dage dare dbox dder demy deo. die. dirt dies dney dpa. dren drop dune dyna dys. eads eak. eal. ear. ease east eats eave eces eck. eded eeds eedy eek. eel. eels eeny egg egs. ein. eing eins eld. eler eles eis. emy. ener ensy eout eper erey erg. eria ero. esk. esks etch etle face fect feit ffee fice flat fly. fort füll gain gary gdom gee. gey. ghed ghs. ghty ging glad gl« gnal gold got. grab grah gris gut. had. hah. hall 1 (conL) (cont) (conL) (cont) (conL) (cont) 1 able abys ado. adow ads. ady. aels affé age. ager aha. airy aits ake. alie alks ama. amel amp. ana. anes ann. anns ans. span aper •ppy aps. arm. ards arks arts arol aron arts asle asy. ated ato. ault aves awer awls bage band bara bbie bble beak bean beat bee. bels berg best blow bob. bone born bowl bras bun. busy but. cado caff cage carl case cave cean ced. cee. cees cer. che. chew hare hark harp has. hatd hed. hee. heep help herd hern hest hia. hind hits hnny hoot hop. hope horn hted hth. huff hum. hund ick. icos iday ider ides idow iest ieve ifer iff. iffs iger iian iis. iked ile. ilk. its. ina. ince inda inds ines inet inna ints iny. 633 1 1 1 (cont.) (conL) (conL) irds ired irt. isa. ismo ites itll ium. iver ixed ixes ixth jack jars jill joel joke kah. keet ker. leery key. kie. kies kles knee lab. lamb laps lars lash lays ldve lean leen leis lem. lief lies lift lips lix. lien 1ms. load loma lond lot. loud lown lsie Ison Ive. okey Iver olds lys. oils lyu. oman mad. onia mal. onth mamb ooch mato oods meat oof. meet ools men. oose mer. oots moms opes mond ords moon orge must orld nace orry nana ory. ncel oshy ncer osts nces otch ncy. oted ndle otor ndow otts ndra ouch near ount nese ovie nge. owna nica ozo. nior pace nite paid nked pal. nken park nned part nob. paws nors paynth. peas nths pell nto. pend nton pers nut. pery nute pets oach pine oads pish oaks pie. oal. plug oats pony obe. poon obin pose ods. pots oken ppyokes psie FIRST G R A D E 634 1 1 1 1 (com) (cont.) (cont.) (cont.) puts rack rage rags rank rash sely set. shop size sky. slam rate slap rave sles raws smee ray. snap rdys sor. tea. sore reds ssel rell sson rely ssor rata step rene stie rge- stin rgh. stle rgia sual rgos such rgue suit ries suzy rip- tall rips tars rise tead rls. teep rly. ten. rner tent rns. teve road the. roU thia rang ths. ront tice roo. tim. ror. tin. rots tine roup tips row. tist rser tier rses tly. rsey toby rten toe. rtin toon rue. top. rves tsie scab tte. scar tted SCO. tton seed tuce seen tuck seil tys. uary ubby uch. uck. ucks ucky uds. uffs ugly uick uild ume. ummy unds unt. unts uppy ups. ure. ured ures urgh uric um. urth usan ushy ust. ute. uys. uzie vase vick vide wait wall waps warm wder wear wee. ween weve who. wich wide will wim. wled wman wnie wood wool worn wowu xes. xty. yed. yon. yone yons ypes yum. zans zzy. 8.11.2 Third Grade Tables of Word-final tetragrams Third Grade 267 then 90 hing 46 33 24 19 (corn) (cont.) hats king them some make ming 200 87 nted ool. this oing 45 32 one. oom. ould from talk you. 77 says hem. 198 know just 23 18 44 31 eyre ater 178 75 now. back fter each they ause esnt play irst 42 made into 167 71 ouse 30 ough ling that dont room came name 22 rted 164 70 41 29 akes 17 have bout ways day. head yeah hers hink door 158 65 only hree girl ther ing. 39 him. her. 28 21 last 142 56 over home ears ning even ones like real 27 fish 38 rday 139 55 ere. atch four 16 well eres take live hole when ttle hese once all. 37 imes ting nday 116 54 eah. lets ried ight with goes mber 20 side oure ding tell 114 52 26 enty too. here idnt 36 hool ers. ster hat. out. kind 15 112 omes ying shes amed went 48 ter. away 25 used ead. said 35 106 want ally baby fell 19 half what ball 47 34 ever and. hday 94 down come osed cant lace were ound Idnt ght. ught time took 24 ings your very hose •mean 14 call gets lied nder ngcr ring 13 ack. cher did. does ened miss next ooks own. pers 11 9 8 see. sins stay tart told tuff unch way. nny. ntil ocks off. ome. ovie med same ters tion tter unny ver. whos work rty. ses. shot sing tein tend urns ven. 7 6 5 5 4 orah ose. paul rash reat rite seen ssus tead teps ubin uff. walk ween who. will yard yes. yone yway ents eton ets. eye. felt foot ghts gone hear high hile hits hts. ides ied. iki. ions ired irl. ive. job. junk ked. kets kill lass i»y lide lisa mall man. mens mmer moms navy nele ndle ndow ndry nice odel omma (com.) (cont.) (cont.) (cont.) (conL) (cont.) (cont) (conL) 10 aper bike good hael hair his. hope ime. 12 ird. hrew keep hrow lder lock look ock. sick pped use. ride ving teen 9 two. alls 11 asnt arts bear bird eked give fire fore guys kept icks live ide. more iend oday ills oor. irty open liar ople many orse most read nine 636 8 ace. ach. air. alk. ard. days eep. ends gain gave guyhelp hen. hich hite huh. ider ies. iris ives lack mily nded ood. part oney ore. orty our. ping rent ress rock rows 7 rten ame. sent ames shed ants than aunt thes body trip boys turn cky. ugh. dnt. und. eat. urs. eeps was. ent. wood ess. year ging hes. 6 hird addy ice. ains iece andy ion. ange irds ark. key. ayed lean bed. ler. blew long boy. lows care lucy ched mite ches mped cond nee. dred nes. eady ngs. ear. oked est. old. face feet gher hand hate heir inc. ins. kes. lady lars move nake oes. oull rade rds. ree. rgot ront ruck sits ssed sses sted ten. till tore trap ture usin wear wish best book cago cent cket cans een. ells end. ery. fall find ger. hill ick. icky ifty ike. its. ish. ist. kiki land leep left Ies. Iley lote love mbed ment mes. mile 5 mine ain. ned. alf. nged any. nnis ards nock army ommy ars. oons aves ooth been ope. 4 agic ail. arn. bbot boat bury cake cave cles cook cost dads den. der. dest dies dog. egg elf. ell. T A B L E S OF W O R D - F I N A L T E T R A G R A M S 4 3 ond. ook. ork. orks ory. owed pens pick rage reet row. rrot rse. rson sand say. sell show stop tice tics tied tmas umps usan wash wing ays. bber bit. blow born both cary cess cuts dark dead died dirt die. can. east eek. eft. ello else ence etty feel fith flew food full fun. 3 3 (com) (conL) (conL) (conL) kin. knew Uys Ich. lies lish llow Us. lone lood lost lse. mad. mans med. mess much ndon ner. ney. ngle nks. nnel nose not. nths oard oat. 3 ghty okay abin gold oks. ombs able hest ade. hews onal aded hips ong. adys hoes ons. ago. hout ont. how. oody ails ican aint ools airs ico. oon. iger airy oot. ake. •lie opus also ind. orms ama. inea oset aim. ink. oups ands inks ours anut ire. outh appy irts outs are. isas oved ared ise. oyer arth itch phen ium. pher ase. ass. ived pion aurs Icay. pits rary rch. rees rene rink rmy. rang rook rown rat. sery set. sets ship shoe size snow SOTS spit sten stle sure ted. teep tens teve tist ties ton. tons tory tted uble uch. uck. uess upid urad ure. ures urn. uses ushy utes vies wait wake wall wled woke youd zoo. 2 aces acks adds adnt ads. aids aise aid. ales alks anne ans. aret arm. arty atty awls axis bad. bage band bars bbit ber. big. bins bits ble. boar bomb boss bowl cado camp can. card ced. CCS. chen cil. cken clam cord crab cubs cus. dada dart deep des. digs dogs doll 2 2 2 2 dow. draw dust earn. card earn eave eed. eeth ians ias. ids. iest ikes iU. Uly Uy. ince inds ips. ised isit ited ites its. ity. iver jane net. nia. nit. nky. nner non. nows nth. ody. odys ogs. oise ola. oils oily orce ord. orm. orn. orst orth orts osts ouch oud. ous. ovel ower owns oxes pack pany pedo pet. pie. pigs pink pook poon poor pull push puts rack rah. rain ramp rang rank rap. rass reus rdly ream red. res. rget ries rine rium mer rope ross rot. roup rrel rrie rror rses rtle rue. run. saw. sday sers shey shut sked skey soap sort spot ssau ssy. swer swim Ubs tail tain tall tch. tent tes. tier tole tone tree trol tte. tten ucer uhuh ular uld. 2 1 1 1 637 1 1 (cant) (conL) (conL) (cont.) (cont.) (cont.) (conL) (cont.) (cont.) (cont eggs ein. eird eith els. elve eone era. erry eth. eyes fast feed ful. game gar. gged grow guns had. hang hard hare heck heep held hell hey. hick hide hike hind hip. hirt hnut hold hone hot. hour hua. hung hunt hurt jayjump kah. kick lcid. kiss Up. late Ibow lear lege less limp lion lise Uced Uy. log. logs lose loud Ison lve. mell mese mond mpty nade ncil nds. neck nell ners ulls unce unk. unt. unts uple urch urt. uts. vee. vers ward wave wboy week wers wet. why. wild wind wnie word wuh. yen yjay yon. zza. ance ancy anns ant. arch arol arry art. ary. ash. ason aste ate. ated ath. athe ats. atzo ave. avy. awl. aws. aybe ayer ayon ayor azy. bags 1 bang aah. bank aby. bar. acht bara acky beds acts bend ader beta adn. bies ady. bite age. bles aggy blue agon bly. boo. aid. bor. aig. aigs bors brea aits aked brew aken bus. aled bush alex cabs als. cape alse car. amey cats ana. cean cept cey. ceys che. cial cid. cila cing city cker ckie cks. clay coat cold corp cows crow ctly ctor cula dad. daid darn dden dder ddle ddy. ddys ded. dee. dels dent dess dies dly. dma. don. dor. dren drop duck eads eany ease easy eats ebra eces eclcs ect. edes edge edo. eeds eelcs eels eeow eesh eet. efa. eles elt. emon enie enly enny ens. ente enth en to eons eper eps. ered eria erlo erms ese. esk. etas eter eway ewed ewis eyoo eze. fake farm fat. fice ling flat fman fool for. fort frog fted film. gail gart geon gers get. ggie ggle ggsghed gho. gigi glue gner goga gon. gosh grab grew grey hack hall hank hark hase hens heyd heys homs liore hows hter hty. huge hup. cia dea ded dge dis eld eve g«y ghgns gs let lla Im. mbs men mos ms. nch nda ned nes ingy inky inst ires irt. iser ises ital ite. iter itic itll ival ixth ixty jady japs jays jeff joe. join judy keet kens ker. kers ket. keys kids kie. kies kish kler knee kson kull lain lake lame lamy laps lar. las. lat. lawn Ided Iden led. leg. legs lest lett 638 1 THIRD 1 1 1 1 1 ooby oods oof. ooky ooms oops oots ophy opic oppy ops. ords ores oro. oser osh. ost. otch ott. oubt ount ove. oves owe. owel ows. oys. pace page paid pain papa park pat. peak peas ped. pede peek pend per. pery pew. phew phur pies pile pit. pie. pong pool ppet pple scab pril sea. puh. seek raft self raid sey. raig seys rami she. rant shhh raps shop rat. sie. rate sign rave sile rawl sion raz. sket fbie skin rder sky. rel. sles rels snt. rely soft rens sold rey. son. rib. soon rich sor. rie. sore rips sser ris. ssie rive sson rket step stic rid. rles such rlos suns rman sur. mia tal. road tand ron. tank rons tant rops tape rose tary rote tayo rove tear rowe tgun rsey thed rter thin rtly tic. rts. tide nice ties ruit tiff runs tine rved tiny rver tive rway tie. saur tner 1 (cont.) (COTL) (cont.) (com.) (corn.) (conL) (corn.) lex. IgK lice liff limb tits lix. Iks. Uer Imet lob Ion. loor lor. lot lout low. lown Iped lthy Its. lued lush Iver Ives mach maid mals mary mas. mble medy meet mer. mice milk mind moke mom. mous mper mps. mpus must nap. nary nazi nces nch. ndid ndpa neak neat nee. nel. nek nese nety nges nies nife nior nka. nly. nne. nnie nnys noon note nous nte. nter nts. nue. nues num. nut. oal. oar. oast obby ocky oda. oden odes oisy oke. okes olds oles olor ols. olts oman omed oms. omus omy. ona. onds oner ongo onny onor toon tors toy. toys try. tti. ttic ttie ttom tuck tudy tute uals uaid ucky ucys uda. IMS. uice uild uins ula. ulie umbs ump. unds ung. uns. uppy ured urnt ute. uth. uum. uzie vels vely vite vity vous waii war. ware weet whee whem wide wim. wins wns. wolf won. wont worm wrap ybar ybug yego yell yet. yoo. york zos. GRADE 8.11.3 Fifth Grade Tables of Word-final tetragrams Fifth Grade 298 130 68 (corn.) know down oing ould 274 67 they 126 what hat. 261 124 63 like dont ttle 230 that 107 61 ause some 218 have 95 60 yeah ever 216 then 94 57 ing. hree 194 went king ther 87 56 173 ight said this 86 55 172 with even ound well 82 shes 157 hats 54 when 81 her. 144 now. 53 were 80 says 143 them here your 50 ally 140 78 real bout eah. 49 135 73 time just over 48 130 69 erts hing kint used 47 hink ting 46 Ave 45 hers 44 ere. from 42 very 41 atch ldnt ster ught ways 40 ings mean 39 one. play ying 38 back goes 37 eyre name 36 cher last 35 26 19 body hem. enty does heU only 25 made ding miss 33 ears most good ling ool. hool ring out. omes ried 24 took all. 18 32 esnt akes take gave ater half four 31 imes into ball ives iris work long 23 ming ning 30 fish cant lied nted oom. day. ght. 22 ough hese came ouse ter. eek. teen ople than 29 oure told each ugh. uple fter way. 21 hose 17 room next ssus once ame. osed arts 28 tell book heir too. girl him. ving many you. nder 20 ood. 27 give rent come head tter irst lets 16 kind rted want tart ayed feet guys 16 (com.) 13 11 9 8 orks mer. nine rest move nny. rope nee. nth. unch nds. nths wont ngs. oes. 15 ocks oked also 10 orse ook. and. 12 ack. ovie owed «per pped cept ays. ends ree. lace baby face rgot rds. make been hate ront same hen. ross sand mber call ping died heyd ssed sday stop send read dred iles tens sent sort fore ish. sked will hard jump test ifty lass und. ton. unny tuff 14 isnt nts. ard. mily oday wice ture uess arks old. ork. usin 8 asnt ore. own. ddle port talk ace. wing year did. side yard ble. yes. boy. gets tie. brew 7 hole ver. 9 cats ames iend 11 alks days ant. ime. en ed are. ably alls irty ate. mes. ants ark. fire foot big. nday boys art. shed dog. best gain care show ents both gone ces. ess. tion ers. eked guy hair etic his. ead. etty hite eads 13 ies. ain. ikes ging home east amed itch iday how. eeks hrew ceii. away kept ine. ides eet. cond knew ins. ¡sty land eggs ent. live How ells keep mine ive. more ence milk ones liar ion. kids rday 640 7 6 6 eyll feU hael hand ied. ious lack lane lays left Ies. lock much nger not. nyon ong. orty ouch part pull rong salt seen sick tain tand tch. ten. uch. ure. week dent door drop eady ean. earn eat. ell. ens. est. fair ghts hark high hird ical ice. ions ites lish Iked lley look mall moms nele nish noon oman ose. ours oyer raid raw. ress ride rty. sion son. stay tes. tice tick tree tten turn two. uff. utes ven. yone (cont.) (cont.) (conL) (cont.) (corn.) (cont.) (cont.) Off. ooks rite ters till use. 6 ands ange ards ates ave. cken cks. cold 5 able aby. adc. ads. ady. air. arly ars. ase. aybe ber. card cess ches ctor dnt. dogs ear. card ect. eeps elf. elly else erre ets. eyes foil get. had. hams T A B L E S OF W O R D - F I N A L T E T R A O R A M S 641 4 4 4 3 2 2 2 5 5 3 3 2 2 2 2 (COOL) (cont) (cont) (COOL) (cont) (cont) (cont) (cont) (cont) (conL) (cont) (cont) (cont) (conL) (conL) hatd hear he*. hold huh. ion ided ieoe iked ile. ilyn ines ink. ist. iver liin tood heck hich tory umps hine ust. hot vent hows wait hrow walk was. wish youd zona 4 ach. acks adly age. ahua aken ance ason ass. ated a thy ayer band mped baum must bee. oka. bike ome. bird oon. bomb ope. bove orth cat. ovcd cial oves cky. oys. claw reek dads row. done rive earn. iked ecky rned eddy road eer. roke eing era. rote rson eye. shot fast sing gers gher sits sure got. tamp gray team gton halk ths. Ian ler. Uer lb. Iom lot be. man. mask mmer oney ons. open orts ots. ott. hum. ount ick. our. icky ous. ide. ouve park ike. ill. pen. ince per. ind. pets inds pook ined pool inus quit ire. rade isc. ramp rían ite. yway dk> dt. 3 enth acre erow need nia. nice nita ock. ades ests farm odys ago. ail. Bee okay ains find ona. ake. food onal aid. free onth ab. game oof. amps gate oots ano. ghty ords •ppy gold orid am. golf ort. beet ory. artz help OSS. «ryash. hike ost. athe hill ower ats. hind pan. ited rock atzo hirt pear ived rons aunt hour pell ject roof babe hout pera jock rout bad. iab pes. kay. rows bath ian. pie. lady see. bbed iest pper lake sees bble pril ild. lant ship bby. ilk. rack Ider shut bies illy rain lect sket blem iner ram. leep skin bles inst rand rary snt. blic ips. legs lems sore boat ista rash limb sses boss Jeff reak lub. sted cago join red. mark stly car. kens reel ment such cing kill regg mps. tic. cle. late rget nch. tiny club less ries nes. tops cord ley. rine nese tors cout lice rids ness trip cted Met rman nis. ttom desk lly. roat nnis tude dick lost rode diet lots roup nows urs. usan dway mart rown ntil nty. ute. ease mind ret. nute ves. easy mite rvin oard weve eats mule self oat. wide ebby ncil ses. oke. wind eels nded set. omic wood eeze ndry sive size sons »ten ans. dive hall list apan dly. ham. lood aped drag hday loor draw hick loud stle aps. sua) area dry. hile love surf eal. hmm. lucy aris swer aiky eems hoes mach swim arms eep. hook mab hts. tead arry ees. mans ted. hurt maud ased egg tery asic iah. mbia egstied asks eign ial. meet tier aste ekey iano mela tier eks. ible mell asy. tmas atom eld. ich. ndys torn. audy elix nets icks ider tore augh d v e nety tudy avy. emed idge ney. uble bass end. ids. nge. udah bear enny ier. nged uing bers eone ieve ngle eow. ifth uite ngry bite ulah blue eral iing nica ung. blyu ered iled nium um. born erse ills nnet urth box. eta) ily. nnie vie. eter inch nore cal. ¡net wave camp eve. ntly ween can. ezed inia nut. wer. case fing inor oden who. cave fins iot. odge why. cean flat ird. odle oins wins cent flea ires irl. cer. fled oise 2 ched flip irt. oisy aces chez for. ith. okyo aeb cise ivel olds fill. aiah cker full iven olm. ails fun. ixty ont. ckle aint coat gary job. oody airs coin gear july ooky aise ger. cott june ools aldy ctly gest kets ooms ales cuba gger kite oot. alf. lean orch cute ggs. ama. dden ghed leen ord. Bins. dead gle. lege ores ana. dear gned lers orm. ancy deep gon. let. ors. andy der. gree libu orst lies osh. ane. ders gue. anny dest gure line otel rtz. rank sari seas outs sell sign ove. owns sins ozen sir. sles pal. pals slot paws sney ped. soon pee. sta. pens step pick stry pies sts. pipe stys pits suit plan taly poor tape pop. tary tend ppy push tera puts ties rail tish rams ties razy tly. ream toad tor. rees res. town resh trol tron rest rich tty. rie. tuck riod tute rip. type rist tzo. rls. ubs. rly. ucky mer uiet ron. ull. rout umb. rove uns. row. uoia rre. uppy rrie ures rrow urro rse. urse rses uses rth. usic rtin vee. warm rts. ouds oull oup. outh wash west wet. wise wore wow. xes. ycle yday yet. ynor yon. york zero 1 abbi abe. abit ache achs acht acts addy ader adio adnt adys ael. afe. ager ages aggy agic ague aid. aids aims aisy aker aks. alsa alse alt. anch anes anic anne anta any. ared ares FIFTH GRADE 642 1 1 1 1 1 1 1 1 leys lie. liff lift lila lina lion lip. Ho. Imes lope loyd Ited Iter luck lung lus. lve. main mary mass mbed meat med. medy mens mess mint moke mond mous mple mpoo mud. mula nada nail nald naps nary navy naw. nces ncis ndy. neak near neat neck ned. nedy ner. net. neys nges nic. nie. nies nife nix. njoy nkie nks. nned nnys nock nors nose note nter nus. oach oad. oaks oal. oats obby odds odel ody. ofed ogs. ohn. ohns oice oin. oken oles olf. olin oily olt. oms. oned ongs onne onny ony. ooh. oona oop. oor. oose oouh 1 1 ops. opus oran orce ored orn. orus oser oses osis osit ossy oter oth. otts otty oups ourt ousy oute owl. oxes pace pack page paid pain pam. past pat. pez. pher pies pogo pose pots pox. ppen pply pted quet quez rado rage ran. rang rank rant rate raws rce. rele rder rdo. rdon reas rect reen rely ren. rere rger rgia rgic rham rib. rica ril. rink ris. rium rize rker rid. rlo. rms. rney rnia ms. rols rom. rome rots rry. iter rue. rus. ruth rved rves san. save saw. say. scar scle seal seem seph sert sets she. shop sic. 1 1 1 (COM.) (com.) (com.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) (cont.) aret arf. arm. army ams arty aser ases ast. aths atie atll ator aud. aves avid awer awn. ayno bama bang bare bars bbee bber bbys beds bell belt bet. bill bina bly. bone bors bump bunk busy but. cana cans caps cara cars chew chup chy. cil. cils cino cket ckey ckie ckys clay coke colm coon cope copy crap crib cts. cubs cuda cups cuss cuts dad. dale damn dan. dans davy ddie ddy. dea. dera des. dew. dful dger dges dian diet die. diff dine dirt dka. doll don. dona dow. dren drew dump duty earns cans eas. eash eath ebra ebud ece. eces eck. eda. eder edge edle eed. eel. eets efer eft. egas ege. eged egro ehow eila eird elet elow elp. eis. eman emar ems. enge enus eon. eons eper eppy eras erce erch ereo erk. erly em. ero. eros erry ert. ese. esk. esno ete. ett. etts ety. eum. eys. eyve eze. fact fake fat. fee. feel few. fly. lied fine fith flag flap fle. flew fly. foam foil form gas. gedy ges. gged gham gill gine gion glad gled glue gly. gnal goat gobs gosh gram grow gum. guns gust haas hah. hain hale hape hare hed. heel heep held hens hief hies hips hits hnny hone hood hoot hop. hope horn host hove hris hten hter hth. huck humb hund hung huts iams iar. iate iced icia idea ield iet. ife. iff. ific iful igh. ighs igin ign. igns iian ilds ilms inal inge ingo inny iods ios. iple ipts irds ired iron irs. irtz ises ism. ison iss. ita. •tal itll ity. ium. i van ixed ixth jack jake jay. jazz joan jobs joe. john joke judy kegs ken. kes. ket. key. kick kid. kies kip. kle. kled kman kyo. lags lah. lamb lame lank lap. lard lay. ldve leap leas led. lept si Is sily sin. sink sist site six. skim sks. sle. sler snow sor. span spot ssie sson ssum ssy. stab stal sue. sues suzy swam tact tail tal. tals tant tar. tate tato tay. tchs teel teer tein tel. tely tent teps term the. thes tin. tina tips tire tist tive toes tone tons top. tom trai tras try. tues tung tzos ual. uare uary uche udge udio udy. uiiy uits ulls ult. uly. ummy unce unds uner unk. upid ups. urch ured urry urt. urts urve ush. usie usy. uth. uts. uys. ved. veil vers vice vide vil. vin. vis. vous wall wded weet wel. wers whos wife wim. wine wns. woke word worm wrap wson wung xon. xth. xtra yden yer. yers yler yley yons yro. zard zed. zes. zzy. 8.11.4 Adnk Tables of Word-final tetragrams Adult 227 that 73 oing 46 were 28 18 her. take into 204 70 45 time they ould king 27 tion with good ving 182 43 high well 69 when ool. 17 ally over ears 166 40 ster hich know 67 them many now. want 26 ring 141 yeah ght. says like 39 hree ying 64 hool 24 140 hink 16 here 36 from back what 61 your ent. very 23 irst 138 35 body lly. 57 been kids ment have ause logy 34 said 135 hat. 15 just oure some ess. 56 tter fter 109 then 33 ion. dont ople 22 kind 54 down last 101 eah. 32 most real bout more work 52 ound 21 92 mean ught hese 14 ing. hum. arty 51 31 only ding 88 ever cant ttle egro hing ight you. enty ther this 20 give 30 even heir 83 49 much hose Idnt hats eyre ways teen ting 28 tell 74 idnt 19 year ere. 47 ings come went ough eres (corn.) 13 hole ink. told too. 12 aybe eeks ers. etty fore hem. huh. keep lind live ming next rday sort ter. way. 11 akes all. and. ars. ime. isnt ling long look love ning ogy. ood. reat rent shes sure talk tary 11 (cont.) than till took 10 ain. ance ball ends ents esnt four ical ine. nee. nior out. self uple 8 ably anta atch eher day. each card eing ell. find ging ixty lock make need rse. sing uite vent will 7 6 5 (cont.) (cont) (cont.) osed ours rked sion such try. uch. uess ugh. ure. word yes. 6 are. ated ater ched cond een. 9 7 eks. ace. ame. enee appy ass. fun. cken gine ate. blem dent girl came done guys est. ear. hers lass earn him. less east hone eat. ice. lets life eyve iked Iked half iris mber iend its. mmer imes lace ngs. ined mes. ous. ives nine ouve job. oard ping name ore. rted ness part rue. njoy rbon ture nted roes one. ront 644 rson same see. seem ses. sign sses sted urse ver. was. wing youd lish lize llow lose move must need nds. off. once ored ork. orld outh oved able pass ader pend ago. pie. ajor rade asnt rbed ber. ree. care rned cial room door smog eave son. ect. tics ects ties edit ton. eems tory five type fill. ular goes und. hope urf. ided used ike. walk inks week ions ween ited wer. ites weve ived wim. ject wont lars yne. 5 4 ack. amed ant. army art. ason ates call camp cket ctor ded. does can. elf. else ered erly far. feel game ges. gets hall hand hatd hile hite iate ica. idea ides ied. ield ife. ill. ince isco ist. ity. kill lain lane 4 4 lege lems lot. lton lver main mmar nder nes. nice nny. nths ody. ons. ook. ooks ope. orge orks orts oung ouse oyed pus. rder read rful ried ries rink rmal road rove rty. sand seen show ssed tain tand tead ted. test tuff uble unny utes yway 3 (corn.) (cont-) (cont) els. ened enth eous era! erry eyes 3 fact aces feet aken fell also fer. ane. flew ard. folk area for. away free ayed gent ays. gers bad. gest band gist ble. gone book gro. bom guy. bove hate boys head cee. hear cent help cept hen. ches hild city his. eked hour cope ¡ent cted ies. deal ifty dger iful dren iles eady ille easy ills eek. illy eet. ind. eful inds eld. irth elor irty TABLES O F W O R D - F I N A L T E T R A G R A M S 645 1 3 2 2 2 2 1 1 1 1 1 1 1 1 3 (com.) (conL) (corn.) (conL) (conL) (conL) (conL) (conL) (conL) (com.) (com.) (conL) (conL) (corn.) (com.) ive. ¡zed ken. kets knew Unt laps lem. libu kxis lub. lubs made math med. mog. mula ncle nded nere nety nica nion nish nner nows nts. oes. ome. ona. oned onut ooms oped ords orry orty ory. oull our. plan ppiy rage rat. red. rily rite rive rize rid. rses sect sfer ship sics sity snap stay stop sych tate tely ten tice tor. tudy uage ules unds use. uses vee. war. yer. 2 ades idly afes aii. ains ike. alks lis. ames amp. ands ange anon any. ape. aper ards arks arly arm. ast. aunt ave. avel aves bed. bee. bers bit. boat bowl but. buys cal. card cars ces. club ctly cuba dave days ddy. dope dous dred eal. ege. eird ells ench enly ense eon. eone epay eth. eyll eze. fast fax. felt form ger. ghth ghts gosh gton gypt harp hed. hex. hey. hird hnny home hony hout how. iami iant ibs. ¡CO. icts iday ids. iest ieve ifes igh. ile. ious ips. iven iver ixed jobs john jor. kept land las. law. lawn Ider lect left lice lism liar lied lis. lood lse. man. men. mers mike naw. nces nch. ncy. near nest nged nger nkee nks. not. nous nses ntil nut. nute ock. oise okay okes ones ong. ony. oole oor. oot. oots ord. orse ose. osh. ost. ount paid past pent pers phia pUy pies pool pped ppen pper pure push rash rded rds. rest rget rgia rich rior rist mel rnia rang ross rown rows rwin say. seas set. sits skin sons sten sts. surf tact tar. tasy tato tay. tch. the. tore tree trip tual two. uded uff. ulas ult. unch usk. ute. uth. uyer vely ves. waii wait wear wers whos wild wish yet. yone 1 abin abs. aced ach. acks act. ade. aft. age. ages ail. aint air. airs alf. ilk. ami. amos amps anda andy anes anga ank. nine ins. ants aped aps. ara. arah ared ares arge am. arps aste asy. atic atin ator ats. awns ayer azor azy. bara bars base bbit bble big. bits bon. boss both boy. cago can. cans caps cate ced. cide cies cks. cky. coat cons cook cord cort cts. cuts dale damn dapt darn date dden dea. defy den. der. dess dest dge. dian dice did. dime dium die. dog. dogs doll drag drug dson duce earns cans eap. earl eas. ease eath eces ech. eece eech eed. eely eeny eep. eeps eers ees. erae efer eg»l egan eger eges egon egs. ehow eign eila eins eive eles elly elve emed empe ems. enas ency ens. eory ergy eria em. ema erty essy ests etal etic ets. ette eud. eye. face fag. fair fere ffic flee fled fing fish flat flip ford fort frog full gars gave gels get. gger ghed gher ghes gins glegly. gman gned golf gon. gram grow gry. guam gue. gung hair hard hark hash heel hell hens hevy hew. hful hief hind hine hips hiti hman hod. hold hoot hop. hops hove howd hows htub huge hunt hurt husk hyde iage ial. ian. ible ibu. ¡can ices ick. icks ict. idly igns ¡led leon ley. licy lide lies HIT line lity lie. lony loor lor. lost lit. ilty lots inch low. inly lows inor lped int. Isat inue Iso. ¡OS. Ive. ¡pal Ived Ives iple ipts lway ¡red mal. iron mall ised mals ish. mart isk. mas. ¡son mate ¡sta mble ists meet ital mile iti. mily itll mind ival mole jail moms joy. mor. kay. moth kens mous ker. mped ket. mpus key. nant kick navy kid. ndon kirk neat lady ned. lame nees lay. nel. Icos ner. ldve nese lead new. leep nfra nge. ngel nges nia. nist nits nker non. none nown ntal ntan nth. ntly nto. ntry nuts oaks oal. oat. obby obey oca) ocks oday ogs. ohio ohol oice oil. oils oint oisy oked oken old. olds ole. olf. olor omen onde oney ont. oods ools oon. oons oors oose ooth ophy ops. oral orce ores orm. orms om. ore. oret orta orth oses osit otes oth. otic ouls oup. oven oves ovie owed ower pace pare peal pean peat ped. pen. pens per. pert pest pete pity plit plug plus poke port pose pots qua! ract racy raid rain ram. rank rate rawl razy rbit rce. rden rdon reen reer rees reet rely ren. rene rens ress rfed rfer rial rict rida ride rimp riod ris. risk rity rket rks. rls. rly. mer mor roll roro. rome rops rore rote rous row. rred rrow rry. rta. its. rtys runs rus. rush ruth rvey sat. sday ADULT 646 1 1 1 sea. sed. sent ser. sert sest she. shed shop sick side sie. sier sies sily sin. sis. sive sked skey slam slaw sly. smen soon sorb sors soup spit ssic ssor sta. star ston suit swer swim tage tall tant tars tart tess thin thm. ths. tick tiny tire tive tie. tly. tmas torn. tomy tors town tray true tten tty. turn tute uam. uate ucky udes udy. ues. ufly uge. uits ulco uld. ulge ulum umor unce ung. uni. uns. unt. ures urth urts usic usly ust. uts. vade vel. vere vers vice vie. vils vity vors vous weat wed. weet wful who. |